Property Summary

NCBI Gene PubMed Count 62
Grant Count 41
R01 Count 31
Funding $3,870,820.08
PubMed Score 1.41
PubTator Score 48.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
astrocytoma 1.100 0.000
glioblastoma 1.800 0.000
posterior fossa group A ependymoma 3.200 0.000
group 4 medulloblastoma 3.100 0.000
non-small cell lung cancer -1.696 0.000
active Crohn's disease 1.366 0.013
active ulcerative colitis 2.209 0.017
pancreatic cancer 1.400 0.001
interstitial cystitis 1.400 0.003
adult high grade glioma 2.100 0.000
pilocytic astrocytoma 1.900 0.000
lung carcinoma -1.800 0.000
Breast cancer -1.900 0.000
ovarian cancer -1.900 0.000
pituitary cancer -1.100 0.000

Gene RIF (52)

PMID Text
26876179 MCT1 inhibition impairs proliferation of glycolytic breast cancer cells co-expressing MCT1 and MCT4 via disruption of pyruvate rather than lactate export.
26779534 MCT1 expression was not clearly associated with overall or disease-free survival. MCT4 and CD147 expression correlate with worse prognosis across many cancer types. These results warrant further investigation of these associations
26384346 Prognostic significance of CD147 protein expression could not surpass that of MCT4, especially of SLC16A3 DNA methylation, corroborating the role of MCT4 as prognostic biomarker for ccRCC.
26363456 Knockdown of MCT4 blocks lactate efflux to result in lactic acid accumulation and pH dropping, which is involved in triggering apoptosis in HUVECs.
26213210 synovial fibroblasts from patients with rheumatoid arthritis exhibited up-regulated transcription of MCT4 mRNA compared with osteoarthritis patients. Knockdown of MCT4 induced intrinsic apoptosis of fibroblasts, thereby inhibiting their proliferation.
26059436 we showed that genetic disruption of Mct4 and/or Ampk dramatically reduced tumourigenicity in a xenograft mouse model suggesting a crucial role for these two actors in establishment of tumours in a nutrient-deprived environment
25965974 MCT4 expression is regulated by the PI3K-Akt signalling pathway and highly expressed in HER2-positive breast cancers where it regulates tumor cell metabolism and survival.
25957999 The first IF method has been developed and optimised for detection of MCT 1 and MCT4 in cancer patient circulating tumour cells .
25919709 Findings demonstrate that the histidine residue His382 in the extracellular loop of the transporter is essential for pH regulation of MCT4-mediated substrate transport activity.
25578492 we sought to evaluate the associations of nine functional SNPs in genes encoding MCT1, MCT2, and MCT4 with the prognosis in a cohort of 500 Chinese NSCLC patients.
More...

AA Sequence

MLKREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLR      1 - 70
FCAGPLVAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYF     71 - 140
KKRLALSTAIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAIALNLVPSSMLLRPIHIKSENNSGIKD    141 - 210
KGSSLSAHGPEAHATETHCHETEESTIKDSTTQKAGLPSKNLTVSQNQSEEFYNGPNRNRLLLKSDEESD    211 - 280
KVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVS    281 - 350
QIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRN    351 - 420
STVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT       421 - 487
//

Text Mined References (64)

PMID Year Title
26876179 2016 MCT1 Modulates Cancer Cell Pyruvate Export and Growth of Tumors that Co-express MCT1 and MCT4.
26779534 2015 Prognostic Indications of Elevated MCT4 and CD147 across Cancer Types: A Meta-Analysis.
26384346 2015 MCT4 surpasses the prognostic relevance of the ancillary protein CD147 in clear cell renal cell carcinoma.
26363456 2015 High glucose and interleukin 1?-induced apoptosis in human umbilical vein endothelial cells involves in down-regulation of monocarboxylate transporter 4.
26213210 2015 Monocarboxylate transporter 4, associated with the acidification of synovial fluid, is a novel therapeutic target for inflammatory arthritis.
26059436 2015 AMP-activated protein kinase is dispensable for maintaining ATP levels and for survival following inhibition of glycolysis, but promotes tumour engraftment of Ras-transformed fibroblasts.
25965974 2015 Functional screening identifies MCT4 as a key regulator of breast cancer cell metabolism and survival.
25957999 2015 Optimisation of immunofluorescence methods to determine MCT1 and MCT4 expression in circulating tumour cells.
25919709 2014 Involvement of Histidine Residue His382 in pH Regulation of MCT4 Activity.
25578492 2015 Genetic variations in monocarboxylate transporter genes as predictors of clinical outcomes in non-small cell lung cancer.
More...