Property Summary

NCBI Gene PubMed Count 42
Grant Count 6
R01 Count 4
Funding $244,229.17
PubMed Score 26.86
PubTator Score 20.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.143 0.004
Multiple myeloma 1.648 0.000
lung cancer 1.600 0.000
cystic fibrosis -1.500 0.000
group 4 medulloblastoma -1.100 0.003
nasopharyngeal carcinoma 1.200 0.019
ovarian cancer -1.600 0.000

Synonym

Accession O15372 eIF3h
Symbols EIF3S3
eIF3-p40
eIF3-gamma

Gene

PANTHER Protein Class (1)

PDB

3J8B   3J8C  

Gene RIF (15)

PMID Text
24148822 -RAD21 and EIF3H, both on chromosome 8q23, CHRAC1 on chromosome 8q24.3 and TANC2 on chromosome 17q23-were confirmed to be driver genes regulating the proliferation/survival of clonogenic breast cancer cells
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit H (EIF3H) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit H (EIF3H) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20862326 Increased expression of EIF3H gene increases colorectal cancer growth and invasiveness thereby providing a biological mechanism for the 8q23.3 association.
20659471 Observational study of gene-disease association. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20016921 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit H (EIF3H) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19204574 MYC and EIF3H are frequently coamplified in NSCLC and that a high copy number correlates with increased epidermal growth factor receptor tyrosine kinase inhibitors sensitivity.
19204574 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18544531 high eIF3h levels directly stimulate protein synthesis, resulting in the establishment and maintenance of the malignant state in cells.
More...

AA Sequence

MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGL      1 - 70
VVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSY     71 - 140
QHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHL    141 - 210
INVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQR    211 - 280
RQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEY    281 - 350
NN                                                                        351 - 352
//

Text Mined References (53)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24148822 2014 A siRNA screen identifies RAD21, EIF3H, CHRAC1 and TANC2 as driver genes within the 8q23, 8q24.3 and 17q23 amplicons in breast cancer with effects on cell growth, survival and transformation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...