Property Summary

NCBI Gene PubMed Count 45
PubMed Score 27.77
PubTator Score 20.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -1.400 9.4e-05
group 4 medulloblastoma -1.100 3.4e-03
lung cancer 1.600 2.2e-04
Multiple myeloma 1.648 1.1e-04
nasopharyngeal carcinoma 1.200 1.9e-02
ovarian cancer -1.600 5.1e-05
Waldenstrons macroglobulinemia 1.143 3.9e-03

Gene RIF (14)

AA Sequence

MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGL      1 - 70
VVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSY     71 - 140
QHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHL    141 - 210
INVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQR    211 - 280
RQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEY    281 - 350
NN                                                                        351 - 352
//

Text Mined References (57)

PMID Year Title