Tbio | Eukaryotic translation initiation factor 3 subunit H |
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773).
Comments
Disease | Target Count |
---|---|
Colorectal Neoplasms | 217 |
Liver carcinoma | 217 |
Prostatic Neoplasms | 471 |
Disease | Target Count | P-value |
---|---|---|
cystic fibrosis | 1670 | 3.90212188406272E-6 |
ovarian cancer | 8492 | 5.05840801648844E-5 |
Multiple myeloma | 1328 | 1.14977559509546E-4 |
lung cancer | 4473 | 2.243570812898E-4 |
group 4 medulloblastoma | 1875 | 0.00338634029785904 |
Waldenstrons macroglobulinemia | 765 | 0.00394282126707996 |
nasopharyngeal carcinoma | 1056 | 0.0192856250677493 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Breast cancer | 3099 | 0.0 | 2.0 |
Cardiovascular system disease | 194 | 0.0 | 1.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Trichorhinophalangeal syndrome type II | 14 | 4.355 | 2.2 |
Trichorhinophalangeal syndrome type I | 8 | 3.9 | 2.0 |
Disease | log2 FC | p |
---|---|---|
Waldenstrons macroglobulinemia | 1.143 | 0.004 |
Multiple myeloma | 1.648 | 0.000 |
lung cancer | 1.600 | 0.000 |
cystic fibrosis | -1.500 | 0.000 |
group 4 medulloblastoma | -1.100 | 0.003 |
nasopharyngeal carcinoma | 1.200 | 0.019 |
ovarian cancer | -1.600 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
Fruitfly | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
24148822 | -RAD21 and EIF3H, both on chromosome 8q23, CHRAC1 on chromosome 8q24.3 and TANC2 on chromosome 17q23-were confirmed to be driver genes regulating the proliferation/survival of clonogenic breast cancer cells |
22190034 | HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit H (EIF3H) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses |
20862326 | Increased expression of EIF3H gene increases colorectal cancer growth and invasiveness thereby providing a biological mechanism for the 8q23.3 association. |
20659471 | Observational study of gene-disease association. (HuGE Navigator) |
20437058 | Observational study of genetic testing. (HuGE Navigator) |
20016921 | HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit H (EIF3H) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses |
19204574 | MYC and EIF3H are frequently coamplified in NSCLC and that a high copy number correlates with increased epidermal growth factor receptor tyrosine kinase inhibitors sensitivity. |
19204574 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
18544531 | high eIF3h levels directly stimulate protein synthesis, resulting in the establishment and maintenance of the malignant state in cells. |
18187620 | Knockdown of eukaryotic translation initiation factor 3, subunit H (EIF3H) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells |
More... |
MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGL 1 - 70 VVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSY 71 - 140 QHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHL 141 - 210 INVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQR 211 - 280 RQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEY 281 - 350 NN 351 - 352 //
PMID | Year | Title |
---|---|---|
27462815 | 2016 | eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25849773 | 2015 | eIF3 targets cell-proliferation messenger RNAs for translational activation or repression. |
25064007 | 2014 | A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine. |
24737748 | 2014 | Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
24148822 | 2014 | A siRNA screen identifies RAD21, EIF3H, CHRAC1 and TANC2 as driver genes within the 8q23, 8q24.3 and 17q23 amplicons in breast cancer with effects on cell growth, survival and transformation. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22969067 | 2012 | Genetic variants near PDGFRA are associated with corneal curvature in Australians. |
22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. |
More... |