Property Summary

NCBI Gene PubMed Count 34
PubMed Score 12.50
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
27462815 eIF3d makes specific contacts with the RNA cap, as exemplified by cap analogue competition, and these interactions are essential for assembly of translation initiation complexes on eIF3-specialized mRNAs such as the cell proliferation regulator c-Jun
26617750 Knockdown of eIF3D inhibited breast cancer cell proliferation and invasion.
25682860 EIF3D plays an important role in modulating glioma cell growth and migration.
25370813 Findings suggest that eukaryotic translation initiation factor 3 subunit D (eIF3D) might play an important role in colon cancer progression.
25322666 the critical involvement of EIF3D in the survival and progression of melanoma cells
24092755 eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome.
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit D (EIF3D; eIF3-zeta), Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit D (EIF3D; eIF3-zeta), Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit D (EIF3D; eIF3-zeta), Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit D (EIF3D; eIF3-zeta), Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYA      1 - 70
YFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQILPKSAKQKERERIRLQKKF     71 - 140
QKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRIT    141 - 210
TRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDK    211 - 280
RDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDK    281 - 350
NEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV    351 - 420
IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGI    421 - 490
LRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEET                491 - 548
//

Text Mined References (52)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
27035563 2016 EIF3D silencing suppresses renal cell carcinoma tumorigenesis via inducing G2/M arrest through downregulation of Cyclin B1/CDK1 signaling.
26617750 2015 Knockdown of eIF3D inhibits breast cancer cell proliferation and invasion through suppressing the Wnt/?-catenin signaling pathway.
26036682 2015 The oncogenic role of EIF3D is associated with increased cell cycle progression and motility in prostate cancer.
26008152 2015 Knockdown of eIF3d inhibits cell proliferation through G2/M phase arrest in non-small cell lung cancer.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25682860 2015 RNAi-Mediated Silencing of EIF3D Alleviates Proliferation and Migration of Glioma U251 and U87MG Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25370813 2014 Lentivirus-mediated knockdown of eukaryotic translation initiation factor 3 subunit D inhibits proliferation of HCT116 colon cancer cells.
More...