Property Summary

NCBI Gene PubMed Count 38
PubMed Score 15.86
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.600 3.4e-02
acute quadriplegic myopathy 1.554 3.2e-09
dermatomyositis 1.300 5.8e-04
diabetes mellitus -1.600 1.2e-03
group 3 medulloblastoma 1.200 5.8e-04
intraductal papillary-mucinous neoplasm ... -1.900 1.3e-03
lung cancer 1.100 1.8e-02
medulloblastoma, large-cell 1.200 9.8e-05
mucosa-associated lymphoid tissue lympho... -1.093 9.3e-03
Multiple myeloma 1.484 4.3e-03
oligodendroglioma 1.100 1.7e-02
ovarian cancer -1.600 1.5e-04
pancreatic cancer -1.200 6.6e-04
primary pancreatic ductal adenocarcinoma -1.262 1.1e-03

Gene RIF (12)

AA Sequence

MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYA      1 - 70
YFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQILPKSAKQKERERIRLQKKF     71 - 140
QKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRIT    141 - 210
TRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDK    211 - 280
RDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDK    281 - 350
NEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV    351 - 420
IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGI    421 - 490
LRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEET                491 - 548
//

Text Mined References (55)

PMID Year Title