Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.51
PubTator Score 5.52

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 4.45475820747388E-17
malignant mesothelioma 3163 4.76526765600276E-6
lung cancer 4473 1.34825945956468E-4
group 3 medulloblastoma 2254 2.8753115273018E-4
oligodendroglioma 2849 0.0172160905219009
Disease Target Count Z-score Confidence
Collecting duct carcinoma 3 3.475 1.7


  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
oligodendroglioma 1.100 0.017
group 3 medulloblastoma 1.700 0.000
non-small cell lung cancer 1.215 0.000
lung cancer 2.500 0.000


Accession O15370 Q5D038 Q9NUD4
Symbols SOX22


  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid

Gene RIF (4)

25704764 Up-regulated Sox12 induced by FoxQ1 promotes hepatocellular carcinoma invasion and metastasis by transactivating Twist1 and FGFBP1 expression.
24920608 This genome-wide screen has identified two novel metastatic suppressors: TMED3 and SOX12, the knockdown of which increases metastatic growth after direct seeding.
24019301 SOX12 and NRSN2 were identified as candidate genes that may be involved in the developmental defects in 20p13 microdeletion.
185058 Functional analysis of the orthologous mouse gene.

AA Sequence

GTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY                                       281 - 315

Text Mined References (13)

PMID Year Title
25704764 2015 Sox12, a direct target of FoxQ1, promotes hepatocellular carcinoma metastasis through up-regulating Twist1 and FGFBP1.
24920608 2014 A novel genome-wide in vivo screen for metastatic suppressors in human colon cancer identifies the positive WNT-TCF pathway modulators TMED3 and SOX12.
24019301 2013 SOX12 and NRSN2 are candidate genes for 20p13 subtelomeric deletions associated with developmental delay.
18505825 2008 Sox12 deletion in the mouse reveals nonreciprocal redundancy with the related Sox4 and Sox11 transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11222737 2001 Floppy SOX: mutual induced fit in hmg (high-mobility group) box-DNA recognition.
11071752 2000 Phylogeny of the SOX family of developmental transcription factors based on sequence and structural indicators.
9215677 1997 SOX22 is a new member of the SOX gene family, mainly expressed in human nervous tissue.