Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.00
PubTator Score 5.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.700 2.9e-04
lung cancer 1.900 4.5e-05
malignant mesothelioma 1.100 4.8e-06
non-small cell lung cancer 1.215 4.5e-17
oligodendroglioma 1.100 1.7e-02

Gene RIF (6)

AA Sequence

MVQQRGARAKRDGGPPPPGPGPAEEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEI      1 - 70
SKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGP     71 - 140
QLPGRGGRRAAGGPLGGGAAAPEDDDEDDDEELLEVRLVETPGRELWRMVPAGRAARGQAERAQGPSGEG    141 - 210
AAAAAAASPTPSEDEEPEEEEEEAAAAEEGEEETVASGEESLGFLSRLPPGPAGLDCSALDRDPDLQPPS    211 - 280
GTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY                                       281 - 315
//

Text Mined References (15)

PMID Year Title