Property Summary

NCBI Gene PubMed Count 26
PubMed Score 40.13
PubTator Score 33.06

Knowledge Summary

Patent (3,177)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 1.02363648660087E-8
lung cancer 4473 7.82183180446965E-8
oligodendroglioma 2849 2.70419265072243E-7
atypical teratoid/rhabdoid tumor 1095 2.01978206481469E-6
group 4 medulloblastoma 1875 1.22282394171084E-5
non-small cell lung cancer 2798 1.306490257385E-5
astrocytoma 1493 1.59704635838669E-5
pilocytic astrocytoma 3086 1.24554473075261E-4
glioblastoma multiforme 347 2.25839956114681E-4
medulloblastoma, large-cell 6234 2.27013464089656E-4
ovarian cancer 8492 5.3530955855448E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 7.9085867532202E-4
Down syndrome 548 0.0024644455072769
ductal carcinoma in situ 1745 0.00296288181477399
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00338046926447501
interstitial cystitis 2299 0.00338740763490187
head and neck cancer 270 0.00356873255372753
ependymoma 2514 0.00660268326998898
active Crohn's disease 918 0.00975564516062188
subependymal giant cell astrocytoma 2287 0.009915428900871
lung adenocarcinoma 2714 0.0121456549930704
Endometriosis 535 0.0181617553320401
primitive neuroectodermal tumor 3031 0.0297448736207193
chronic kidney disease 90 0.0381320801475154
Disease Target Count Z-score Confidence
Parkinson's disease 364 4.792 2.4

Expression

Synonym

Accession O15354 A4D0Y6 O00348 O14768 Q8TD39
Symbols PAELR
EDNRBL
hET(B)R-LP

Gene

PANTHER Protein Class (2)

  Ortholog (8)

  TechDev Info (2)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model

Gene RIF (13)

PMID Text
25977097 GPR37 was shown to be a component of the CASPR2-MUPP1 complex in brain.
25169131 GPR37 may play an important role in the pathogenesis of hepatocellular carcinoma by affecting the proliferation of HCC cells.
24290813 Positive role of GPR37 in the proliferation of multiple myeloma cells.
23690594 GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin.
23251443 results suggested that some alleles in GPR37 were related to the deleterious effect of ASD. GPR37 is associated with the dopamine transporter to modulate dopamine uptake, and regulates behavioral responses to dopaminergic drugs
20424473 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19799451 GPR37 surface trafficking in heterologous cells can be greatly enhanced by N-terminal truncation, coexpression with other receptors, and coexpression with syntenin-1.
19218498 Data show that GPR37 overexpression can induce cellular autophagy, which may prevent the selective degeneration of GPR37-expressing neurons, as reported for Parkinson's and related neurodegenerative diseases.
18691389 Parkin-ko/Pael-R-tg mice represents an AR-JP mouse model displaying chronic and selective loss of catecholaminergic neurons.
More...

AA Sequence

MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRAR      1 - 70
APREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPT     71 - 140
ALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGW    141 - 210
TIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNL    211 - 280
AVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTF    281 - 350
TLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI    351 - 420
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQM    421 - 490
NCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCKPFSRAF    491 - 560
MECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC                     561 - 613
//

Text Mined References (26)

PMID Year Title
25977097 2015 CASPR2 forms a complex with GPR37 via MUPP1 but not with GPR37(R558Q), an autism spectrum disorder-related mutation.
25169131 2014 A low level of GPR37 is associated with human hepatocellular carcinoma progression and poor patient survival.
24290813 2014 The role of the orphan G protein-coupled receptor 37 (GPR37) in multiple myeloma cells.
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23690594 2013 GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23251443 2012 Mutation in Parkinson disease-associated, G-protein-coupled receptor 37 (GPR37/PaelR) is related to autism spectrum disorder.
21372109 2011 Absence of the GPR37/PAEL receptor impairs striatal Akt and ERK2 phosphorylation, DeltaFosB expression, and conditioned place preference to amphetamine and cocaine.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...