Property Summary

NCBI Gene PubMed Count 19
Grant Count 87
R01 Count 61
Funding $14,550,337.97
PubMed Score 184.65
PubTator Score 55.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.396 0.000
interstitial cystitis -1.700 0.003

Synonym

Accession O15353 B2R9Q7 O15352
Symbols WHN
RONU
FKHL20

Gene

Gene RIF (14)

PMID Text
26352270 Whole-exome sequencing in a South American cohort links ALDH1A3, FOXN1 and RARB/retinoic acid regulation pathways to autism spectrum disorders.
25173801 Identification of a unique mutation in FOXN1 that led to severe combined immunodeficiency in a female infant is reported.
24383669 These results show that miR-18b and miR-518b are upstream controllers of FOXN1-directed epithelial lineage development.
23922987 The retinoid-related orphan receptor RORalpha promotes keratinocyte differentiation via FOXN1.
22721479 This is the first description of leucoderma occurring in a patient with Foxn1 deficiency, as well as the first report of this pigment abnormality following thymus transplantation.
21507891 results show that FOXN1 is crucial for in utero T cell development, but not for B and NK cell differentiation
20634891 Observational study of gene-disease association. (HuGE Navigator)
20429426 role of FOXN1 in immunological disorders characterized by abnormal T-cell development or abnormal T-cell regulatory homeostasis [Review]
19729838 study uncovered a positive regulatory loop between FGFR3 and FOXN1 that underlies a benign versus malignant skin tumor phenotype
17803914 Foxn1/FGF2 pathway involved in instructing melanocytes where to place pigment.
More...

AA Sequence

MVSLPPPQSDVTLPGPTRLEGERQGDLMQAPGLPGSPAPQSKHAGFSCSSFVSDGPPERTPSLPPHSPRI      1 - 70
ASPGPEQVQGHCPAGPGPGPFRLSPSDKYPGFGFEEAAASSPGRFLKGSHAPFHPYKRPFHEDVFPEAET     71 - 140
TLALKGHSFKTPGPLEAFEEIPVDVAEAEAFLPGFSAEAWCNGLPYPSQEHGPQVLGSEVKVKPPVLESG    141 - 210
AGMFCYQPPLQHMYCSSQPPFHQYSPGGGSYPIPYLGSSHYQYQRMAPQASTDGHQPLFPKPIYSYSILI    211 - 280
FMALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKSGSSSRKGCLWALNP    281 - 350
AKIDKMQEELQKWKRKDPIAVRKSMAKPEELDSLIGDKREKLGSPLLGCPPPGLSGSGPIRPLAPPAGLS    351 - 420
PPLHSLHPAPGPIPGKNPLQDLLMGHTPSCYGQTYLHLSPGLAPPGPPQPLFPQPDGHLELRAQPGTPQD    421 - 490
SPLPAHTPPSHSAKLLAEPSPARTMHDTLLPDGDLGTDLDAINPSLTDFDFQGNLWEQLKDDSLALDPLV    491 - 560
LVTSSPTSSSMPPPQPPPHCFPPGPCLTETGSGAGDLAAPGSGGSGALGDLHLTTLYSAFMELEPTPPTA    561 - 630
PAGPSVYLSPSSKPVALA                                                        631 - 648
//

Text Mined References (22)

PMID Year Title
26352270 2015 Whole-Exome Sequencing in a South American Cohort Links ALDH1A3, FOXN1 and Retinoic Acid Regulation Pathways to Autism Spectrum Disorders.
25173801 2014 A novel mutation in FOXN1 resulting in SCID: a case report and literature review.
24432845 2014 FOXN1 in organ development and human diseases.
24383669 2014 miR-18b and miR-518b Target FOXN1 during epithelial lineage differentiation in pluripotent cells.
23922987 2013 The retinoid-related orphan receptor ROR? promotes keratinocyte differentiation via FOXN1.
23874334 2013 FOXN1: A Master Regulator Gene of Thymic Epithelial Development Program.
22721479 2012 [Post-thymus transplant vitiligo in a child with Foxn1 deficiency].
21507891 2011 FOXN1 mutation abrogates prenatal T-cell development in humans.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20429426 2009 Human clinical phenotype associated with FOXN1 mutations.
More...