Property Summary

NCBI Gene PubMed Count 19
PubMed Score 184.65
PubTator Score 55.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.396 0.000
interstitial cystitis -1.700 0.003

Synonym

Accession O15353 B2R9Q7 O15352
Symbols WHN
RONU
FKHL20

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (14)

PMID Text
26352270 Whole-exome sequencing in a South American cohort links ALDH1A3, FOXN1 and RARB/retinoic acid regulation pathways to autism spectrum disorders.
25173801 Identification of a unique mutation in FOXN1 that led to severe combined immunodeficiency in a female infant is reported.
24383669 These results show that miR-18b and miR-518b are upstream controllers of FOXN1-directed epithelial lineage development.
23922987 The retinoid-related orphan receptor RORalpha promotes keratinocyte differentiation via FOXN1.
22721479 This is the first description of leucoderma occurring in a patient with Foxn1 deficiency, as well as the first report of this pigment abnormality following thymus transplantation.
21507891 results show that FOXN1 is crucial for in utero T cell development, but not for B and NK cell differentiation
20634891 Observational study of gene-disease association. (HuGE Navigator)
20429426 role of FOXN1 in immunological disorders characterized by abnormal T-cell development or abnormal T-cell regulatory homeostasis [Review]
19729838 study uncovered a positive regulatory loop between FGFR3 and FOXN1 that underlies a benign versus malignant skin tumor phenotype
17803914 Foxn1/FGF2 pathway involved in instructing melanocytes where to place pigment.
More...

AA Sequence

MVSLPPPQSDVTLPGPTRLEGERQGDLMQAPGLPGSPAPQSKHAGFSCSSFVSDGPPERTPSLPPHSPRI      1 - 70
ASPGPEQVQGHCPAGPGPGPFRLSPSDKYPGFGFEEAAASSPGRFLKGSHAPFHPYKRPFHEDVFPEAET     71 - 140
TLALKGHSFKTPGPLEAFEEIPVDVAEAEAFLPGFSAEAWCNGLPYPSQEHGPQVLGSEVKVKPPVLESG    141 - 210
AGMFCYQPPLQHMYCSSQPPFHQYSPGGGSYPIPYLGSSHYQYQRMAPQASTDGHQPLFPKPIYSYSILI    211 - 280
FMALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKSGSSSRKGCLWALNP    281 - 350
AKIDKMQEELQKWKRKDPIAVRKSMAKPEELDSLIGDKREKLGSPLLGCPPPGLSGSGPIRPLAPPAGLS    351 - 420
PPLHSLHPAPGPIPGKNPLQDLLMGHTPSCYGQTYLHLSPGLAPPGPPQPLFPQPDGHLELRAQPGTPQD    421 - 490
SPLPAHTPPSHSAKLLAEPSPARTMHDTLLPDGDLGTDLDAINPSLTDFDFQGNLWEQLKDDSLALDPLV    491 - 560
LVTSSPTSSSMPPPQPPPHCFPPGPCLTETGSGAGDLAAPGSGGSGALGDLHLTTLYSAFMELEPTPPTA    561 - 630
PAGPSVYLSPSSKPVALA                                                        631 - 648
//

Text Mined References (22)

PMID Year Title
26352270 2015 Whole-Exome Sequencing in a South American Cohort Links ALDH1A3, FOXN1 and Retinoic Acid Regulation Pathways to Autism Spectrum Disorders.
25173801 2014 A novel mutation in FOXN1 resulting in SCID: a case report and literature review.
24432845 2014 FOXN1 in organ development and human diseases.
24383669 2014 miR-18b and miR-518b Target FOXN1 during epithelial lineage differentiation in pluripotent cells.
23922987 2013 The retinoid-related orphan receptor ROR? promotes keratinocyte differentiation via FOXN1.
23874334 2013 FOXN1: A Master Regulator Gene of Thymic Epithelial Development Program.
22721479 2012 [Post-thymus transplant vitiligo in a child with Foxn1 deficiency].
21507891 2011 FOXN1 mutation abrogates prenatal T-cell development in humans.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20429426 2009 Human clinical phenotype associated with FOXN1 mutations.
More...