Property Summary

NCBI Gene PubMed Count 513
Grant Count 349
R01 Count 206
Funding $31,830,802.51
PubMed Score 80.57
PubTator Score 804.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.200 0.000

Gene

PANTHER Protein Class (1)

PDB

4A63   2MPS   1COK   1DXS   2KBY   2WQI   2WQJ   2WTT   2XWC   3VD0   3VD1   3VD2   4G82   4G83   4GUO   4GUQ   5KBD  

Gene RIF (478)

PMID Text
26907686 data suggest that PCBP2 regulates p73 expression via mRNA stability and p73-dependent biological function in ROS production and cellular senescence.
26711266 This review establishes the possibility that p73 is indeed capable of both promoting and inhibiting angiogenesis, depending on the cellular context. [review]
26625870 our study demonstrates a novel mechanism of PLK2 in promoting tumor progression, whereby it directly binds to enriched TAp73, catalyzes Ser48 phosphorylation of TAp73, and inhibits TAp73 transcriptional activity
26554827 Mechanistic investigations indicated that DNp73 acted by attenuating expression of miR-885-5p, a direct regulator of the IGF1 receptor (IGF1R) responsible for stemness marker expression.
26529454 Each nucleotide position in the response element has a different influence in determining the binding of the p73 DNA-binding domain.
26435500 Hades (MUL1)-mediated p73 ubiquitination is a novel regulatory mechanism for the exonuclear function of p73.
26429976 data support the hypothesis that the DeltaNp73/TAp73 ratio is an important determinant of clinical response in APL and may offer a therapeutic target for enhancing chemosensitivity in blast cells.
26392358 Data indicate tumor suppressors TP73, RASSF1A, MLH1 and BRCA1 as possible biomarkers to distinguish Pleomorphic invasive lobular cancer (pleomorphic ILC} from classic ILC and infiltrative ductal cancer (IDC).
26267146 Similar to TAp73, DNp73 is stabilized by hypoxia in a HIF-1a-dependent manner, which otherwise is degraded by Siah1.
26184366 p73 overexpression and concomitantly decreased promoter methylation are significantly associated with poor survival in children with Wilm's tumor.
More...

AA Sequence

MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSS      1 - 70
TMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSA     71 - 140
TWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAP    141 - 210
ASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMR    211 - 280
DGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHG    281 - 350
DEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG    351 - 420
MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSHCTPPPPYHAD    421 - 490
PSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQL    491 - 560
LRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEF    561 - 630
TEAEIH                                                                    631 - 636
//

Text Mined References (517)

PMID Year Title
26907686 2016 RNA-binding Protein PCBP2 Regulates p73 Expression and p73-dependent Antioxidant Defense.
26711266 2015 p73: a Positive or Negative Regulator of Angiogenesis, or Both?
26625870 2016 PLK2 phosphorylates and inhibits enriched TAp73 in human osteosarcoma cells.
26554827 2016 p73 and IGF1R Regulate Emergence of Aggressive Cancer Stem-like Features via miR-885-5p Control.
26529454 2015 Sequence Variation in the Response Element Determines Binding by the Transcription Factor p73.
26435500 2015 Ubiquitination-dependent degradation of p73 by the mitochondrial E3 ubiquitin ligase Hades.
26429976 2015 High ?Np73/TAp73 ratio is associated with poor prognosis in acute promyelocytic leukemia.
26392358 2015 Methylation biomarkers for pleomorphic lobular breast cancer - a short report.
26267146 2015 Hypoxia-induced DNp73 stabilization regulates Vegf-A expression and tumor angiogenesis similar to TAp73.
26184366 2016 Evaluation of promoter hypomethylation and expression of p73 as a diagnostic and prognostic biomarker in Wilms' tumour.
More...