Property Summary

NCBI Gene PubMed Count 26
PubMed Score 32.38
PubTator Score 19.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O15347 O95556 Q6NS40
Symbols HMG4
HMG-4
HMG2A
HMG-2a

Gene

PDB

2EQZ   2YQI  

Gene RIF (9)

PMID Text
25755721 these findings demonstrate that HMBG3 may be a potential molecular marker for predicting the prognosis of esophageal squamous cell carcinoma patients
25647262 our data suggests HMGB3 may serve as an important oncoprotein and indicate that overexpression of HMGB3 in urinary bladder cancer could be used as a potential prognostic marker.
25095979 High expression of HMGB3 is associated with lymph node metastases in gastric cancer.
24993872 In this family, microphthalmia, microcephaly, intellectual disability, and short stature are associated with a mutation on the X chromosome in the HMGB3 gene.
24338397 Association between co-expression networks involving HMGB3 and differentially-expressed genes in gastric cancer.
24098490 regulation of HMGB3 by miR-205 reduced both proliferation and invasion of breast cancer cells.
23609034 HMGB3 plays an important role in non-small cell lung cancer progression.
23326140 HMGB3 has a role in gastric cancer disease onset and progression by regulating the cell cycle
22912879 Data indicate that myomiR-206 modulates Hmgb3 expression during myogenesis.

AA Sequence

MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVR      1 - 70
YDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQ     71 - 140
PYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEEEEEEEEEEEEEEDE              141 - 200
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755721 2015 Increased expression of HMGB3: a novel independent prognostic marker of worse outcome in patients with esophageal squamous cell carcinoma.
25647262 2015 Overexpression of HMGB3 protein promotes cell proliferation, migration and is associated with poor prognosis in urinary bladder cancer patients.
25416956 2014 A proteome-scale map of the human interactome network.
25095979 2014 Upregulation of miR-513b inhibits cell proliferation, migration, and promotes apoptosis by targeting high mobility group-box 3 protein in gastric cancer.
24993872 2014 Identification of an HMGB3 frameshift mutation in a family with an X-linked colobomatous microphthalmia syndrome using whole-genome and X-exome sequencing.
24531895 2014 A systematic nomenclature for the redox states of high mobility group box (HMGB) proteins.
24338397 2013 HMGB3 characterization in gastric cancer.
24098490 2013 Tumor suppressive function of mir-205 in breast cancer is linked to HMGB3 regulation.
23609034 2013 Prognostic value of HMGB3 expression in patients with non-small cell lung cancer.
More...