Property Summary

NCBI Gene PubMed Count 28
PubMed Score 33.12
PubTator Score 19.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Microphthalmia, syndromic 13 1 0.0 0.0
Disease Target Count Z-score Confidence
Microphthalmia 76 0.0 4.0

Expression

  Differential Expression (19)

Gene RIF (11)

AA Sequence

MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVR      1 - 70
YDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQ     71 - 140
PYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEEEEEEEEEEEEEEDE              141 - 200
//

Text Mined References (32)

PMID Year Title