Property Summary

NCBI Gene PubMed Count 63
PubMed Score 42.89
PubTator Score 96.25

Knowledge Summary


No data available


  Disease Sources (6)


  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
glioblastoma multiforme 1.100 0.000
osteosarcoma 1.381 0.022
astrocytoma 1.200 0.049
atypical teratoid / rhabdoid tumor 1.200 0.023
chronic kidney disease 1.300 0.018
breast carcinoma -1.500 0.000
group 3 medulloblastoma 1.400 0.004
Breast cancer -2.900 0.000
invasive ductal carcinoma -2.100 0.007
Pick disease 1.300 0.000
ductal carcinoma in situ -1.300 0.001
ovarian cancer 1.600 0.000


Accession O15344 B2RCG2 O75361 Q9BZX5
Symbols OS



2DQ5   2FFW   2JUN   5IM8  

  Ortholog (13)

 GWAS Trait (1)

Gene RIF (38)

25981737 TRAIL regulates MID1 and TSLP, inflammation, fibrosis, smooth muscle hypertrophy, and expression of inflammatory effector chemokines and cytokines in experimental eosinophilic esophagitis.
25874572 A130T/V mutations within the MID1 zinc-binding Bbox1 domain affects protein folding.
25728276 Results revealed S422 as a novel phosphorylation site of Osx and GSK-3b played an important role in regulating the protein stability and transactivational activity of Osx.
25304119 A familial c.1102C>T (p.R368X) mutation in the MID1 gene, is reported.
25278022 Fu ubiquitination and cleavage is one of the key elements connecting the MID1-PP2A protein complex with GLI3 activity control
25216264 These studies provide insight into the mechanism by which mutations observed in X-linked Opitz G syndrome affect the structure and function of the MID1 Bbox1 domain
25207814 MID1 catalyzes the ubiquitination of protein phosphatase 2A and mutations within its Bbox1 domain disrupt polyubiquitination of alpha4 but not of PP2Ac in X-linked Opitz syndrome.
24913494 Promotion of AR, in addition to enhancement of the Akt-, NFkappaB-, and Hh-pathways by sustained MID1-upregulation during androgen deprivation therapy provides a powerful proliferative scenario for PCa progression into castration resistance
24484909 In prostate cancer cells the inhibitory effect of metformin was mimicked by disruption of MID1 translational regulator complex.
24321989 Two patients with underdeveloped arcuate fasciculus had novel, nonsynonymous variants in MID1 and EN2 genes regulating axon guidance pathway.

AA Sequence

VAFAQPVCPTFTVWNKCLTIITGLPIPDHLDCTEQLP                                     631 - 667

Text Mined References (68)

PMID Year Title
25981737 2015 TNF-related apoptosis-inducing ligand (TRAIL) regulates midline-1, thymic stromal lymphopoietin, inflammation, and remodeling in experimental eosinophilic esophagitis.
25874572 2015 Molecular dynamics simulation reveals insights into the mechanism of unfolding by the A130T/V mutations within the MID1 zinc-binding Bbox1 domain.
25728276 2015 Phosphorylation of Serine422 increases the stability and transactivation activities of human Osterix.
25416956 2014 A proteome-scale map of the human interactome network.
25304119 2015 R368X mutation in MID1 among recurrent mutations in patients with X-linked Opitz G/BBB syndrome.
25278022 2014 The E3 ubiquitin ligase MID1 catalyzes ubiquitination and cleavage of Fu.
25216264 2014 XLOS-observed mutations of MID1 Bbox1 domain cause domain unfolding.
25207814 2014 MID1 catalyzes the ubiquitination of protein phosphatase 2A and mutations within its Bbox1 domain disrupt polyubiquitination of alpha4 but not of PP2Ac.
24913494 2014 A hormone-dependent feedback-loop controls androgen receptor levels by limiting MID1, a novel translation enhancer and promoter of oncogenic signaling.
24484909 2014 Metformin anti-tumor effect via disruption of the MID1 translational regulator complex and AR downregulation in prostate cancer cells.