Property Summary

NCBI Gene PubMed Count 69
PubMed Score 44.83
PubTator Score 96.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Opitz-GBBB syndrome 18 6.233 3.1
Disease Target Count
Opitz-Frias syndrome 1

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 4.9e-02
atypical teratoid / rhabdoid tumor 1.100 2.5e-02
Breast cancer -1.200 3.3e-02
breast carcinoma -1.200 7.5e-06
chronic kidney disease 1.100 1.8e-02
ductal carcinoma in situ -1.300 8.8e-04
glioblastoma multiforme 1.100 2.1e-12
group 3 medulloblastoma 1.400 4.1e-03
invasive ductal carcinoma -1.010 9.8e-03
malignant mesothelioma 1.200 7.6e-07
osteosarcoma 1.381 2.2e-02
ovarian cancer 1.600 6.9e-05
Pick disease 1.300 3.2e-04

Gene RIF (42)

AA Sequence

METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCRHVITLSQRGL      1 - 70
DGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVS     71 - 140
YCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVA    141 - 210
ALSERYDKLKQNLESNLTNLIKRNTELETLLAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQII    211 - 280
GTKIKEGKVMRLRKLAQQIANCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLI    281 - 350
PEINLNDTFDTFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI    351 - 420
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLKTNSQPFKLDP    421 - 490
KSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGRHYWEVVISGSTWYAIGLAYK    491 - 560
SAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPHLRRVGILLDYDNGSIAFYDALNSIHLYTFD    561 - 630
VAFAQPVCPTFTVWNKCLTIITGLPIPDHLDCTEQLP                                     631 - 667
//

Text Mined References (74)

PMID Year Title