Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.67
PubTator Score 5.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 2.172 0.000
astrocytoma 1.300 0.012
glioblastoma 1.800 0.000
ependymoma 1.300 0.000
medulloblastoma, large-cell -1.400 0.000
primary pancreatic ductal adenocarcinoma 1.245 0.002
Breast cancer 2.900 0.030
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.500 0.000
subependymal giant cell astrocytoma 1.756 0.006
ovarian cancer 2.400 0.000
Down syndrome 1.300 0.000
pancreatic cancer 1.200 0.002
dermatomyositis 1.500 0.001

Synonym

Accession O15342 B2R557 D3DQM1 Q6IBE8 V-ATPase subunit e 1
Symbols M9.2
ATP6H
Vma21
Vma21p
ATP6V0E

Gene

Gene RIF (2)

PMID Text
17576770 there is an important role for physical association between aldolase and the A, B and E subunits of V-ATPase in the regulation of the proton pump
12163484 Data demonstrate the physiological significance of the interaction between the E and H subunits of V-ATPase and extend previous studies on the arrangement of subunits on the peripheral stalk of V-ATPase.

AA Sequence

MAYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN      1 - 70
ETIWYLKYHWP                                                                71 - 81
//

Text Mined References (22)

PMID Year Title
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
17662945 2007 Coupling of rotation and catalysis in F(1)-ATPase revealed by single-molecule imaging and manipulation.
17576770 2007 Physical interaction between aldolase and vacuolar H+-ATPase is essential for the assembly and activity of the proton pump.
17350184 2007 Molecular cloning and characterization of a novel form of the human vacuolar H+-ATPase e-subunit: an essential proton pump component.
15906478 2005 Full-length coding sequences and mapping of porcine ATP6VOE and ATP5G1 genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14970230 2004 The yeast vacuolar proton-translocating ATPase contains a subunit homologous to the Manduca sexta and bovine e subunits that is essential for function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597263 2003 Neurotransmitter release: the dark side of the vacuolar-H+ATPase.
14580332 2003 Revised nomenclature for mammalian vacuolar-type H+ -ATPase subunit genes.
More...