Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.67
PubTator Score 5.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.400 6.0e-05
astrocytoma 1.100 1.0e-21
Astrocytoma, Pilocytic 1.500 3.8e-11
Breast cancer 2.900 3.0e-02
dermatomyositis 1.500 8.3e-04
Down syndrome 1.300 2.5e-04
ependymoma 1.300 3.3e-16
glioblastoma 1.300 4.0e-09
medulloblastoma, large-cell -1.400 1.3e-04
Multiple myeloma 2.172 1.9e-05
ovarian cancer -1.600 2.4e-06
pancreatic cancer 1.200 1.5e-03
primary pancreatic ductal adenocarcinoma 1.245 1.8e-03
subependymal giant cell astrocytoma 1.756 5.7e-03

Protein-protein Interaction (10)

Gene RIF (2)

AA Sequence

MAYHGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN      1 - 70
ETIWYLKYHWP                                                                71 - 81
//

Text Mined References (22)

PMID Year Title