Property Summary

NCBI Gene PubMed Count 9
Grant Count 15
R01 Count 5
Funding $2,721,225.11
PubMed Score 93.10
PubTator Score 50.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -1.522 0.000
pilocytic astrocytoma 2.800 0.000
psoriasis -2.600 0.000

Gene RIF (3)

PMID Text
23172228 number of cells adhering via their beta(1) integrin receptor to collagen type II or chondroadherin was profoundly and rapidly enhanced by the addition of the heparin-binding peptide
21127050 chondroadherin interaction with cells may be central for maintaining the adult chondrocyte phenotype and cartilage homeostasis.
19525844 Changes in CHAD abundance or structure could be associated with the pathologic changes occurring in the scoliotic IVD.

AA Sequence

MVRPMLLLSLGLLAGLLPALAACPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANS      1 - 70
FRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPR     71 - 140
GLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSY    141 - 210
PSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRL    211 - 280
NQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPT    281 - 350
KRSKKAGRH                                                                 351 - 359
//

Text Mined References (10)

PMID Year Title
23172228 2013 The C-terminal peptide of chondroadherin modulates cellular activity by selectively binding to heparan sulfate chains.
21127050 2011 Identification and characterization of the integrin alpha2beta1 binding motif in chondroadherin mediating cell attachment.
19525844 2009 Variation in chondroadherin abundance and fragmentation in the human scoliotic disc.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11445564 2001 Association of chondroadherin with collagen type II.
9344663 1997 The structure and chromosome location of the human chondroadherin gene (CHAD).
9281592 1997 Integrin alpha2beta1 is a receptor for the cartilage matrix protein chondroadherin.
1939097 1991 Cartilage matrix proteins. A basic 36-kDa protein with a restricted distribution to cartilage and bone.