Property Summary

NCBI Gene PubMed Count 9
PubMed Score 100.34
PubTator Score 50.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.3e-132
adrenocortical carcinoma 1428 2.6e-12
Astrocytoma, Pilocytic 3081 3.9e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Ovarian carcinoma 3 3.115 1.6
Autoimmune hemolytic anemia 31 3.024 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -1.522 2.6e-12
Astrocytoma, Pilocytic 2.800 3.9e-05
psoriasis -2.600 2.3e-132

Gene RIF (3)

AA Sequence

MVRPMLLLSLGLLAGLLPALAACPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANS      1 - 70
FRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPR     71 - 140
GLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSY    141 - 210
PSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRL    211 - 280
NQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPT    281 - 350
KRSKKAGRH                                                                 351 - 359
//

Text Mined References (10)

PMID Year Title