Property Summary

NCBI Gene PubMed Count 51
PubMed Score 41.55
PubTator Score 33.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.179 1.6e-06
adult high grade glioma -1.900 1.1e-07
astrocytic glioma -1.600 1.3e-02
Astrocytoma, Pilocytic -1.400 8.2e-06
atypical teratoid / rhabdoid tumor 3.000 1.2e-03
Breast cancer -1.300 2.4e-03
cystic fibrosis 2.010 7.6e-07
ductal carcinoma in situ 1.400 2.9e-02
ependymoma -1.400 4.6e-02
fibroadenoma 1.400 1.4e-02
glioblastoma -1.400 7.0e-05
group 3 medulloblastoma -1.700 1.5e-05
intraductal papillary-mucinous adenoma (... 1.900 1.9e-02
intraductal papillary-mucinous carcinoma... 1.800 2.1e-02
intraductal papillary-mucinous neoplasm ... 3.900 1.6e-03
invasive ductal carcinoma 2.200 1.3e-03
lung cancer -2.200 5.4e-04
medulloblastoma, large-cell -2.400 3.1e-07
oligodendroglioma -1.300 2.8e-02
osteosarcoma -1.426 1.4e-02
ovarian cancer -1.800 1.8e-03
pancreatic cancer 1.800 1.2e-04
sarcoidosis 1.100 7.2e-03
tuberculosis 2.200 9.1e-08

Gene RIF (41)

AA Sequence

MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHP      1 - 70
VEQSLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDKSHDTVRTSVLPEHKDPPPEV     71 - 140
GRSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIEVSVVKMGEIEDGEADHITTDVQGQKCALVC    141 - 210
ECTAPESVSGKDNLPFLNSVLKNPVCKLYRFPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRN    211 - 280
QEIKELGELSPHWDNLRKNVLTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMQ    281 - 350
VHSPHLKDALYDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL    351 - 420
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGGILKKPPSPKS    421 - 490
STEESSPQDQPPVMRGQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEK    491 - 560
EPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQSLTFVLLQELAYSLPQCLMLTLRRDIVFSQ    561 - 630
ALAGLVCGFIIKLQTSLYDPGFLQQLHTVGLIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAK    631 - 700
SNDVLPVITGRREHYVVEVKLPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESIN    701 - 770
QENFELLQEYYKIFMEKMPPDYISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT    771 - 840
CCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYAFNMLQLMAFPK    841 - 910
YYRPPEGTYGKADT                                                            911 - 924
//

Text Mined References (52)

PMID Year Title