Property Summary

NCBI Gene PubMed Count 40
Grant Count 9
Funding $1,542,551.32
PubMed Score 36.73
PubTator Score 33.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
26700619 Studies indicate that phosphatidylinositol 4-phosphate phosphatase (INPP4B) that acting as tumor suppressors by antagonizing AKT signaling at endosomes.
26577950 The incidence of INPP4B loss of heterozygosity was significantly higher in the triple-negative breast tumor subtype and positively correlated with PTEN loss of heterozygosity.
26573229 Data show that activation of serum- and glucocorticoid-regulated kinase 3 (SGK3) plays an important role in inositol polyphosphate 4-phosphatase type II (INPP4B)-mediated melanoma cell proliferation.
26189250 Seventy-nine percent of the ovarian cancers demonstrated loss of INPP4B, most frequently in serous and endometrioid cancer subtypes.
25883023 Studies in human tissues suggest that reductions in INPP4B and PTEN co-occur in human thyroid and endometrial cancers. INPP4B may therefore be an important regulator of cancer progression, especially in the context of PTEN insufficiency.
25883022 Study provides evidence that INPP4B loss can promote follicular-like thyroid cancer progression and metastasis in the context of PTEN haploinsufficiency through the isoform-specific regulation of AKT signaling at the endosomes.
25868852 Given that INPP4B loss has been found in 40% of ovarian cancer patients, this study provides the rationale for establishing INPP4B as a biomarker of PARP inhibitor response.
25736313 A previously unsuspected and clinically relevant role for INPP4B gain of function as a mediator of chemoresistance and poor survival outcome in AML independent of its phosphoinositide phosphatase function.
25736236 INPP4B overexpression is associated with therapy resistance in acute myeloid leukemia
25542038 There were no significant associations of PIK3CA copy number, pAKt, or INPP4B with trastuzumab efficacy.
More...

AA Sequence

MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHP      1 - 70
VEQSLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDKSHDTVRTSVLPEHKDPPPEV     71 - 140
GRSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIEVSVVKMGEIEDGEADHITTDVQGQKCALVC    141 - 210
ECTAPESVSGKDNLPFLNSVLKNPVCKLYRFPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRN    211 - 280
QEIKELGELSPHWDNLRKNVLTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMQ    281 - 350
VHSPHLKDALYDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL    351 - 420
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGGILKKPPSPKS    421 - 490
STEESSPQDQPPVMRGQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEK    491 - 560
EPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQSLTFVLLQELAYSLPQCLMLTLRRDIVFSQ    561 - 630
ALAGLVCGFIIKLQTSLYDPGFLQQLHTVGLIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAK    631 - 700
SNDVLPVITGRREHYVVEVKLPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESIN    701 - 770
QENFELLQEYYKIFMEKMPPDYISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT    771 - 840
CCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYAFNMLQLMAFPK    841 - 910
YYRPPEGTYGKADT                                                            911 - 924
//

Text Mined References (41)

PMID Year Title
26700619 2016 Endosome and INPP4B.
26577950 2016 Biological and clinical significance of loss of heterozygosity at the INPP4B gene locus in Japanese breast cancer.
26573229 2015 INPP4B is upregulated and functions as an oncogenic driver through SGK3 in a subset of melanomas.
26189250 2015 Prognostic value of INPP4B protein immunohistochemistry in ovarian cancer.
25883023 2015 INPP4B Is a PtdIns(3,4,5)P3 Phosphatase That Can Act as a Tumor Suppressor.
25883022 2015 In Vivo Role of INPP4B in Tumor and Metastasis Suppression through Regulation of PI3K-AKT Signaling at Endosomes.
25868852 2015 Loss of INPP4B causes a DNA repair defect through loss of BRCA1, ATM and ATR and can be targeted with PARP inhibitor treatment.
25736313 2015 Inositol polyphosphate 4-phosphatase II (INPP4B) is associated with chemoresistance and poor outcome in AML.
25736236 2015 INPP4B overexpression is associated with poor clinical outcome and therapy resistance in acute myeloid leukemia.
25542038 2014 An integrative analysis of PIK3CA mutation, PTEN, and INPP4B expression in terms of trastuzumab efficacy in HER2-positive breast cancer.
More...