Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
R01 Count 2
Funding $265,485.5
PubMed Score 1.67
PubTator Score 3.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession O15321 D3DS65 Q86SZ6 Q96FI8
Symbols MP70
HMP70

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (1)

PMID Text
19029833 The results of transmission electron microscopy and immunoblotting to examine LC3-II levels further confirmed the ability of TM9SF1 to induce autophagy.

AA Sequence

MTVVGNPRSWSCQWLPILILLLGTGHGPGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPE      1 - 70
KIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRG     71 - 140
FVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSE    141 - 210
TSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSG    211 - 280
DDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYA    281 - 350
LTCCISGYVSSHFYRQIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWL    351 - 420
LVGFPLTVIGGIFGKNNASPFDAPCRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVW    421 - 490
GREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNM    491 - 560
SGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD                            561 - 606
//

Text Mined References (6)

PMID Year Title
19029833 2009 High-throughput functional screening for autophagy-related genes and identification of TM9SF1 as an autophagosome-inducing gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11595169 2001 The iodocyanopindolol and SM-11044 binding protein belongs to the TM9SF multispanning membrane protein superfamily.
9332367 1997 Cloning of a human multispanning membrane protein cDNA: evidence for a new protein family.