Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.84
PubTator Score 3.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 8.2e-11
atypical teratoid / rhabdoid tumor 5112 2.3e-06
group 3 medulloblastoma 4104 3.6e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Fuchs' endothelial dystrophy 24 3.484 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 2.3e-06
ependymoma 1.100 8.2e-11
group 3 medulloblastoma 1.500 3.6e-05

Gene RIF (2)

AA Sequence

MTVVGNPRSWSCQWLPILILLLGTGHGPGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPE      1 - 70
KIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRG     71 - 140
FVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSE    141 - 210
TSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLVGFVAVILMRVLRNDLARYNLDEETTSAGSG    211 - 280
DDFDQGDNGWKIIHTDVFRFPPYRGLLCAVLGVGAQFLALGTGIIVMALLGMFNVHRHGAINSAAILLYA    281 - 350
LTCCISGYVSSHFYRQIGGERWVWNIILTTSLFSVPFFLTWSVVNSVHWANGSTQALPATTILLLLTVWL    351 - 420
LVGFPLTVIGGIFGKNNASPFDAPCRTKNIAREIPPQPWYKSTVIHMTVGGFLPFSAISVELYYIFATVW    421 - 490
GREQYTLYGILFFVFAILLSVGACISIALTYFQLSGEDYRWWWRSVLSVGSTGLFIFLYSVFYYARRSNM    491 - 560
SGAVQTVEFFGYSLLTGYVFFLMLGTISFFSSLKFIRYIYVNLKMD                            561 - 606
//

Text Mined References (6)

PMID Year Title