Property Summary

NCBI Gene PubMed Count 37
PubMed Score 13.95
PubTator Score 16.43

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O15320 B3KRA6 B4DQS6 D3DSA6 G3XAC5 O00169 Q6MZN2 Q6P2R8 Q86TF6 Q8IX92 Q8IX93 Protein cTAGE-5
Symbols MEA6
MGEA
MGEA6
CTAGE5
MGEA11

Gene

PANTHER Protein Class (2)

 GO Function (1)

Gene RIF (9)

PMID Text
25657029 These findings define an interaction between the common MIA2(I141M) variant and the ER stress/UPR system and specify a subgroup of PDAC patients who are more likely to benefit from adjuvant chemotherapy.
25202031 Sec12 recruitment to endoplasmic reticulum exit sites is organized by its direct interaction with cTAGE5, a previously characterized collagen cargo receptor component, which functions together with TANGO1 at endoplasmic reticulum exit sites.
23511560 Findings suggest that the roles of MIA2 might be based on the variety of the integrins and the subtypes of mitogen-activated protein kinase in oral carcinoma.
23054591 22 members of an Iranian family with basal ganglia calfication as well as 100 controls were genotyped for the C>G P521A variant of CTAGE5, but none were found.
22120627 HBx activates hepatoma cell growth and proliferation through repression of the potential tumor suppressor MIA2.
21525241 cTAGE5 forms a complex with TANGO1 (MIA3), a previously characterized cargo receptor for collagen VII
20838928 population and bioinformatic analysis of MGEA6 P521A variation as a risk factor for Fahr's disease; genetic screen data show this mutation is very rare; bioinformatics analysis provided conflicting findings
17881540 The novel gene MIA2 acts as a tumour suppressor in hepatocellular carcinoma.
12586826 Data indicate that MIA2 represents a potential novel acute phase protein and MIA2 expression responds to liver damage in chronic liver diseases.

AA Sequence

MEEPGVTPQPYLGLLLEELRRVVAALPEGMRPDSNLYGFPWELVICAAVVGFFAVLFFLWRSFRSVRSRL      1 - 70
YVGREKKLALMLSGLIEEKSKLLEKFSLVQKEYEGYEVESSLKDASFEKEATEAQSLEATCEKLNRSNSE     71 - 140
LEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKD    141 - 210
ALNENSQLQESQKQLLQEAEVWKEQVSELNKQKVTFEDSKVHAEQVLNDKESHIKTLTERLLKMKDWAAM    211 - 280
LGEDITDDDNLELEMNSESENGAYLDNPPKGALKKLIHAAKLNASLKTLEGERNQIYIQLSEVDKTKEEL    281 - 350
TEHIKNLQTEQASLQSENTHFENENQKLQQKLKVMTELYQENEMKLHRKLTVEENYRLEKEEKLSKVDEK    351 - 420
ISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTE    421 - 490
TELKFELLEKDPYALDVPNTAFGREHSPYGPSPLGWPSSETRAFLSPPTLLEGPLRLSPLLPGGGGRGSR    491 - 560
GPGNPLDHQITNERGESSCDRLTDPHRAPSDTGSLSPPWDQDRRMMFPPPGQSYPDSALPPQRQDRFCSN    561 - 630
SGRLSGPAELRSFNMPSLDKMDGSMPSEMESSRNDTKDDLGNLNVPDSSLPAENEATGPGFVPPPLAPIR    631 - 700
GPLFPVDARGPFLRRGPPFPPPPPGAMFGASRDYFPPGDFPGPPPAPFAMRNVYPPRGFPPYLPPRPGFF    701 - 770
PPPPHSEGRSEFPSGLIPPSNEPATEHPEPQQET                                        771 - 804
//

Text Mined References (37)

PMID Year Title
27170179 2016 Dual function of cTAGE5 in collagen export from the endoplasmic reticulum.
27138255 2016 TANGO1 and Mia2/cTAGE5 (TALI) cooperate to export bulky pre-chylomicrons/VLDLs from the endoplasmic reticulum.
25657029 2015 A common genetic variation of melanoma inhibitory activity-2 labels a subtype of pancreatic adenocarcinoma with high endoplasmic reticulum stress levels.
25416956 2014 A proteome-scale map of the human interactome network.
25202031 2014 Concentration of Sec12 at ER exit sites via interaction with cTAGE5 is required for collagen export.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23511560 2013 Protumoral roles of melanoma inhibitory activity 2 in oral squamous cell carcinoma.
23054591 2013 Analysis of the CTAGE5 P521A variation with the risk of familial idiopathic basal ganglia calcification in an Iranian population.
22120627 2011 The X protein of hepatitis B virus activates hepatoma cell proliferation through repressing melanoma inhibitory activity 2 gene.
21807889 2011 Reduced cholesterol and triglycerides in mice with a mutation in Mia2, a liver protein that localizes to ER exit sites.
More...