Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.16
PubTator Score 5.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.4e-21
psoriasis 6694 2.5e-07
lung cancer 4740 5.4e-04
group 4 medulloblastoma 1855 1.4e-03
osteosarcoma 7950 3.3e-03
Atopic dermatitis 952 5.0e-03
active Crohn's disease 922 1.8e-02
Disease Target Count Z-score Confidence
Erythema multiforme 17 0.0 1.0
Disease Target Count Z-score Confidence
Capillary leak syndrome 4 3.183 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.447 1.8e-02
Atopic dermatitis 1.100 5.0e-03
group 4 medulloblastoma -1.200 1.4e-03
lung cancer 2.800 5.4e-04
lung carcinoma 1.200 1.4e-21
osteosarcoma -1.521 3.3e-03
psoriasis 1.100 2.5e-07

 MGI Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKR      1 - 70
MPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTED     71 - 140
VLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDF    141 - 210
GADSDDNMDEATY                                                             211 - 223
//

Text Mined References (21)

PMID Year Title