Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.10
PubTator Score 5.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.400 0.000
osteosarcoma -1.521 0.003
Atopic dermatitis 1.100 0.005
lung cancer 2.800 0.001
active Crohn's disease 1.447 0.018
group 4 medulloblastoma -1.200 0.001
lung carcinoma 1.200 0.000

Gene RIF (2)

PMID Text
21898682 Decreased levels of POLR3G result in loss of pluripotency and promote differentiation of human embryonic stem cells to all three germ layers but have no effect on cell apoptosis.
1403646 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC

AA Sequence

MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKR      1 - 70
MPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTED     71 - 140
VLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDF    141 - 210
GADSDDNMDEATY                                                             211 - 223
//

Text Mined References (16)

PMID Year Title
24107381 2014 Gene duplication and neofunctionalization: POLR3G and POLR3GL.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21898682 2011 A novel role for an RNA polymerase III subunit POLR3G in regulating pluripotency in human embryonic stem cells.
21810746 2011 Genome-wide association study identifies variations in 6p21.3 associated with nevirapine-induced rash.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...