Property Summary

NCBI Gene PubMed Count 73
Grant Count 39
R01 Count 30
Funding $1,899,228.93
PubMed Score 85.03
PubTator Score 70.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis -1.100 0.034
osteosarcoma -1.710 0.000
posterior fossa group B ependymoma 2.000 0.000
tuberculosis 1.200 0.000

 MGI Term (1)

Gene RIF (36)

PMID Text
26339569 The aim of the present study was to evaluate the relationship between prostate cancer risk and the presence of single nucleotide polymorphisms in the genes involved in Homologous recombination repair, RAD51, RAD51B, XRCC2 and XRCC3.
26261251 Mutations in epithelial ovarian cancer cases were more frequent in RAD51C (14 occurrences, 0.41%) and RAD51D (12 occurrences, 0.35%) than in RAD51B (two occurrences, 0.06%).
25600502 a novel germ line RAD51B nonsense mutation, and reduced expression of RAD51B in melanoma cells indicating inactivation of RAD51B
25255808 Relative excess risk of breast cancer due to interaction between RAD51L1 single-nucleotide polymorphism and BMI.
24526414 the risk of developing AMD exhibits dose dependency as well as an epistatic combined effect in rs17105278 T>C and rs4902566 C>T carriers and that the elevated risk for rs17105278 T>C carriers may be due to decreased transcription of RAD51B.
24498017 Data indicate that complement factor H (CFH) R1210C and common variants in COL8A1 and RAD51B plus six genes contribute predictive information for advanced macular degeneration (AMD) beyond macular and behavioral phenotypes.
24139550 It confirms that RAD51 paralog mutations confer breast and ovarian cancer predisposition and are rare events.
24022229 This study provides robust evidence for an association of rheumatoid arthritis susceptibility with genes involved in B cell differentiation (BACH2) and DNA repair (RAD51B).
23810717 The HsRAD51B-HsRAD51C complex plays a role in stabilizing the HsRAD51 nucleoprotein filament during the presynaptic phase of homologous recombination.
23108668 Study observed centrosome defects in the absence of XRCC3. While RAD51B and RAD51C act early in homologous recombination, XRCC3 functions jointly with GEN1 later in the pathway at the stage of Holliday junction resolution.
More...

AA Sequence

MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGI      1 - 70
KAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVY     71 - 140
IDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILD    141 - 210
SVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDL    211 - 280
SLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFC    281 - 350
SVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF                                        351 - 384
//

Text Mined References (73)

PMID Year Title
26339569 2015 Polymorphisms of homologous recombination RAD51, RAD51B, XRCC2, and XRCC3 genes and the risk of prostate cancer.
26261251 2015 Contribution of Germline Mutations in the RAD51B, RAD51C, and RAD51D Genes to Ovarian Cancer in the Population.
25600502 2015 Germline RAD51B truncating mutation in a family with cutaneous melanoma.
25416956 2014 A proteome-scale map of the human interactome network.
25255808 2014 Additive interactions between susceptibility single-nucleotide polymorphisms identified in genome-wide association studies and breast cancer risk factors in the Breast and Prostate Cancer Cohort Consortium.
24526414 2014 In-depth analyses unveil the association and possible functional involvement of novel RAD51B polymorphisms in age-related macular degeneration.
24498017 2014 Three new genetic loci (R1210C in CFH, variants in COL8A1 and RAD51B) are independently related to progression to advanced macular degeneration.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
24141787 2014 Breast cancer-associated missense mutants of the PALB2 WD40 domain, which directly binds RAD51C, RAD51 and BRCA2, disrupt DNA repair.
More...