Property Summary

NCBI Gene PubMed Count 73
PubMed Score 85.03
PubTator Score 70.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.800 4.8e-06
psoriasis -1.100 3.4e-02
osteosarcoma -1.710 5.2e-05
posterior fossa group B ependymoma 2.000 6.0e-07
tuberculosis 1.200 3.2e-05

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (36)

PMID Text
26339569 The aim of the present study was to evaluate the relationship between prostate cancer risk and the presence of single nucleotide polymorphisms in the genes involved in Homologous recombination repair, RAD51, RAD51B, XRCC2 and XRCC3.
26261251 Mutations in epithelial ovarian cancer cases were more frequent in RAD51C (14 occurrences, 0.41%) and RAD51D (12 occurrences, 0.35%) than in RAD51B (two occurrences, 0.06%).
25600502 a novel germ line RAD51B nonsense mutation, and reduced expression of RAD51B in melanoma cells indicating inactivation of RAD51B
25255808 Relative excess risk of breast cancer due to interaction between RAD51L1 single-nucleotide polymorphism and BMI.
24526414 the risk of developing AMD exhibits dose dependency as well as an epistatic combined effect in rs17105278 T>C and rs4902566 C>T carriers and that the elevated risk for rs17105278 T>C carriers may be due to decreased transcription of RAD51B.
24498017 Data indicate that complement factor H (CFH) R1210C and common variants in COL8A1 and RAD51B plus six genes contribute predictive information for advanced macular degeneration (AMD) beyond macular and behavioral phenotypes.
24139550 It confirms that RAD51 paralog mutations confer breast and ovarian cancer predisposition and are rare events.
24022229 This study provides robust evidence for an association of rheumatoid arthritis susceptibility with genes involved in B cell differentiation (BACH2) and DNA repair (RAD51B).
23810717 The HsRAD51B-HsRAD51C complex plays a role in stabilizing the HsRAD51 nucleoprotein filament during the presynaptic phase of homologous recombination.
23108668 Study observed centrosome defects in the absence of XRCC3. While RAD51B and RAD51C act early in homologous recombination, XRCC3 functions jointly with GEN1 later in the pathway at the stage of Holliday junction resolution.
23001122 SNP in RAD51B at 14q24.1 was significantly associated with male breast cancer risk
22454379 Single nucleotide polymorphism in RAD51L1 is associated with breast cancer.
22017238 Single Nucleotide Polymorphisms in RAD51L1 gene is associated with glioblastoma.
21852249 rs11249433 at 1p.11.2, and two highly correlated single-nucleotide polymorphisms rs999737 and rs10483813 (r(2)= 0.98) at 14q24.1 (RAD51L1), for up to 46 036 invasive breast cancer cases and 46 930 controls from 39 studies, were genotyped.
21533530 our results suggest that RAD51L1 is unlikely to represent a high-penetrance breast cancer susceptibility gene.
21368091 findings support the notion that DNA repair genes, in particular RAD51L1, play a role in nasopharyngeal carcinoma etiology and development
20610542 polymorphisms in and haplotypes of the RAD51L1 gene, which is involved in the double-strand break repair pathway, modulate gamma-radiation-induced mutagen sensitivity.
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20195514 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19657362 BCR/ABL fragments were used for identifying the sites of BCR/ABL interaction with RAD51B
19330030 A multistage genome-wide association study in breast cancer identifies two new risk alleles at 1p11.2 and 14q24.1 (RAD51L1).
19330030 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19329439 EVL protein is a novel recombination factor that may be required for repairing specific DNA lesions, and that may cause tumor malignancy by its inappropriate expression.
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15701685 motif in the N-terminus of Rad51B serves as an NLS that allows Rad51B to localize to the nucleus independent of Rad51C or BRCA2
14704354 a fragment of Rad51B containing amino acid residues 1-75 interacts with the C-terminus and linker of Rad51C, residues 79-376, and this region of Rad51C also interacts with mRad51D and Xrcc3
12441335 Rad51B protein may have a specific function in Holliday junction processing in the homologous recombinational repair pathway in humans
12427746 Rad51B and Rad51C function through interactions with the human Rad51 recombinase and play a crucial role in the homologous recombinational repair pathway
11978964 involved in the frequently occurring t(6;14) (p21;q23-->q24) in pulmonary chondroid hamartomas
11744692 This work describes the in vitro and in vivo identification of the RAD51B/RAD51C heterocomplex

AA Sequence

MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGI      1 - 70
KAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVY     71 - 140
IDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILD    141 - 210
SVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDL    211 - 280
SLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFC    281 - 350
SVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF                                        351 - 384
//

Text Mined References (73)

PMID Year Title
26339569 2015 Polymorphisms of homologous recombination RAD51, RAD51B, XRCC2, and XRCC3 genes and the risk of prostate cancer.
26261251 2015 Contribution of Germline Mutations in the RAD51B, RAD51C, and RAD51D Genes to Ovarian Cancer in the Population.
25600502 2015 Germline RAD51B truncating mutation in a family with cutaneous melanoma.
25416956 2014 A proteome-scale map of the human interactome network.
25255808 2014 Additive interactions between susceptibility single-nucleotide polymorphisms identified in genome-wide association studies and breast cancer risk factors in the Breast and Prostate Cancer Cohort Consortium.
24526414 2014 In-depth analyses unveil the association and possible functional involvement of novel RAD51B polymorphisms in age-related macular degeneration.
24498017 2014 Three new genetic loci (R1210C in CFH, variants in COL8A1 and RAD51B) are independently related to progression to advanced macular degeneration.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
24141787 2014 Breast cancer-associated missense mutants of the PALB2 WD40 domain, which directly binds RAD51C, RAD51 and BRCA2, disrupt DNA repair.
24139550 2013 Germline mutation in the RAD51B gene confers predisposition to breast cancer.
24022229 2013 Identification of BACH2 and RAD51B as rheumatoid arthritis susceptibility loci in a meta-analysis of genome-wide data.
23810717 2013 The HsRAD51B-HsRAD51C stabilizes the HsRAD51 nucleoprotein filament.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23468962 2013 A genome-wide scan for breast cancer risk haplotypes among African American women.
23455636 2013 Seven new loci associated with age-related macular degeneration.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23149936 2013 Rad51 paralog complexes BCDX2 and CX3 act at different stages in the BRCA1-BRCA2-dependent homologous recombination pathway.
23108668 2013 The RAD51 paralogs ensure cellular protection against mitotic defects and aneuploidy.
23001122 2012 Genome-wide association study identifies a common variant in RAD51B associated with male breast cancer risk.
22454379 2012 Common breast cancer susceptibility variants in LSP1 and RAD51L1 are associated with mammographic density measures that predict breast cancer risk.
22232737 2012 Novel genetic markers of breast cancer survival identified by a genome-wide association study.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22017238 2012 DNA-repair gene variants are associated with glioblastoma survival.
21965664 2011 hSWS1·SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.
21852249 2011 Associations of common variants at 1p11.2 and 14q24.1 (RAD51L1) with breast cancer risk and heterogeneity by tumor subtype: findings from the Breast Cancer Association Consortium.
21533530 2011 Mutation analysis of RAD51L1 (RAD51B/REC2) in multiple-case, non-BRCA1/2 breast cancer families.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21368091 2011 Comprehensive pathway-based association study of DNA repair gene variants and the risk of nasopharyngeal carcinoma.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237344 2010 Performance of common genetic variants in breast-cancer risk models.
20207730 2010 Ring-shaped Rad51 paralog protein complexes bind Holliday junctions and replication forks as visualized by electron microscopy.
20195514 2010 Genome-wide association study reveals multiple loci associated with primary tooth development during infancy.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19657362 2009 BCR/ABL kinase interacts with and phosphorylates the RAD51 paralog, RAD51B.
19330030 2009 A multistage genome-wide association study in breast cancer identifies two new risk alleles at 1p11.2 and 14q24.1 (RAD51L1).
19329439 2009 Recombination activator function of the novel RAD51- and RAD51B-binding protein, human EVL.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
15701685 2005 Nuclear localization of Rad51B is independent of Rad51C and BRCA2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14704354 2004 Domain mapping of the Rad51 paralog protein complexes.
14595808 2003 Identification of chromatin-related protein interactions using protein microarrays.
12975363 2003 Functional interaction between the Bloom's syndrome helicase and the RAD51 paralog, RAD51L3 (RAD51D).
12649198 2003 Fusion transcripts involving HMGA2 are not a common molecular mechanism in uterine leiomyomata with rearrangements in 12q15.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441335 2003 Holliday junction binding activity of the human Rad51B protein.
12427746 2003 Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro.
12118380 2002 Impaired DNA damage-induced nuclear Rad51 foci formation uniquely characterizes Fanconi anemia group D1.
11978964 2001 Intragenic breakpoint within RAD51L1 in a t(6;14)(p21.3;q24) of a pulmonary chondroid hamartoma.
11842113 2002 Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells.
11842112 2002 Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells.
11751636 2001 Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange.
11751635 2001 Identification and purification of two distinct complexes containing the five RAD51 paralogs.
11744692 2002 RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51.
10938124 2000 The Rad51 paralog Rad51B promotes homologous recombinational repair.
10565301 1999 hREC2, a RAD51-like gene, is disrupted by t(12;14) (q15;q24.1) in a uterine leiomyoma.
9892177 1999 Allelic knockout of novel splice variants of human recombination repair gene RAD51B in t(12;14) uterine leiomyomas.
9878257 1998 Analysis of the human RAD51L1 promoter region and its activation by UV light.
9788630 1998 The human REC2/RAD51B gene acts as a DNA damage sensor by inducing G1 delay and hypersensitivity to ultraviolet irradiation.
9512535 1998 Isolation of novel human and mouse genes of the recA/RAD51 recombination-repair gene family.
9469824 1998 Isolation and characterization of RAD51C, a new human member of the RAD51 family of related genes.
9441753 1997 Identification of a novel human RAD51 homolog, RAD51B.
9207106 1997 Isolation of human and mouse genes based on homology to REC2, a recombinational repair gene from the fungus Ustilago maydis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
6261043 1980 Cell surface receptors for endogenous mouse type C viral glycoproteins and epidermal growth factor: tissue distribution in vivo and possible participation in specific cell-cell interaction.
4595808 1974 Preservation and transplantation of human cadaver kidneys. Experiences with the Gamgro perfusion unit.