Property Summary

NCBI Gene PubMed Count 37
PubMed Score 71.70
PubTator Score 65.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Coxsackievirus Infections 6 0.0 0.0
Disease Target Count P-value
group 3 medulloblastoma 4104 1.9e-03
osteosarcoma 7950 5.5e-03
non primary Sjogren syndrome sicca 891 2.4e-02
Disease Target Count Z-score Confidence
Scapuloperoneal myopathy 6 4.008 2.0
Reducing body myopathy 7 3.577 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.9e-03
non primary Sjogren syndrome sicca 1.300 2.4e-02
osteosarcoma 1.133 5.5e-03

Gene RIF (25)

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPES      1 - 70
PKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVR     71 - 140
TCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET                                       141 - 175
//

Text Mined References (38)

PMID Year Title