Property Summary

NCBI Gene PubMed Count 37
Grant Count 18
R01 Count 14
Funding $1,016,476.71
PubMed Score 66.31
PubTator Score 65.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.133 0.005
group 3 medulloblastoma 1.200 0.002
non primary Sjogren syndrome sicca 1.300 0.024

Gene RIF (26)

PMID Text
26406409 Loss of SIVA1 expression is associated with nasopharyngeal carcinoma.
25813352 These findings collectively reveal a novel role for the p53 target gene SIVA both in regulating metabolism and in enabling tumorigenesis, independently of p53.
25431847 electrical stimulation -inducible SIVA1 modulates p53 activities in proliferating keratinocytes, and exogenous electrical stimulation affects p53/HDM2/SIVA1 axis leading to increased proliferation during re-epithelialization
25374190 Functional test demonstrated that Siva1 significantly inhibited the invasion and migration of HCT116 cells.
24958773 SIVA1 interacts with RAD18 and serves as a molecular bridge between RAD18 and PCNA, thus targeting the E3 ligase activity of RAD18 onto PCNA.
23462994 Siva1 promotes the ubiquitination and degradation of ARF, which in turn affects the stability of p53.
22343716 Upon stimulation of thromboxane A2, degradation of Siva1 is impeded, resulting in an accumulation of the protein, which translocates from the nucleus to the cytosol.
21955384 negative regulator of IL-2 gene expression in Treg cells
21768358 Data show that low levels of Siva1 and Ser16-phosphorylated stathmin correlate with high metastatic states of breast cancer cells.
21048035 These findings suggest that the caspase-dependent pathway for induction of apoptosis is involved in Siva-1-mediated influenza A virus replication.
More...

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPES      1 - 70
PKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVR     71 - 140
TCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET                                       141 - 175
//

Text Mined References (38)

PMID Year Title
26406409 2015 Anticancer activity of recombinant Siva1 protein in human nasopharyngeal carcinoma cell line CNE-2.
25813352 2015 The p53 Target Gene SIVA Enables Non-Small Cell Lung Cancer Development.
25431847 2015 Electrical stimulation enhances epidermal proliferation in human cutaneous wounds by modulating p53-SIVA1 interaction.
25374190 2014 Preliminary research on the expression, purification and function of the apoptotic fusion protein, Sival.
24958773 2014 SIVA1 directs the E3 ubiquitin ligase RAD18 for PCNA monoubiquitination.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23462994 2013 Siva1 inhibits p53 function by acting as an ARF E3 ubiquitin ligase.
22343716 2012 Thromboxane A2 modulates cisplatin-induced apoptosis through a Siva1-dependent mechanism.
21955384 2011 Regulation of IL-2 gene expression by Siva and FOXP3 in human T cells.
21768358 2011 Siva1 suppresses epithelial-mesenchymal transition and metastasis of tumor cells by inhibiting stathmin and stabilizing microtubules.
More...