Property Summary

NCBI Gene PubMed Count 98
Grant Count 72
R01 Count 39
Funding $4,279,793.33
PubMed Score 162.21
PubTator Score 127.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -3.033 0.000
group 3 medulloblastoma 2.100 0.003
lung cancer -1.600 0.002
subependymal giant cell astrocytoma -2.105 0.013
invasive ductal carcinoma -1.360 0.001
spina bifida -1.387 0.047
ovarian cancer -1.700 0.000

Synonym

Accession O15297 Q53XP4 Q6P991 Q8IVR6
Symbols WIP1
PP2C-DELTA

Gene

Gene RIF (88)

PMID Text
26847329 Chemotherapy exposure and age influence the accumulation of PPM1D mutations in the peripheral blood mononuclear cells of ovarian cancer patients.
26824362 squalene inhibits the ATM-dependent signaling pathway following DNA damage through intracellular induction of Wip1 expression.
26714478 PPM1D suppresses pancreatic cancer cell apoptosis via inhibition of the p38 MAPK/p53 pathway through both dephosphorylation of p38 MAPK and downregulation of ASPP2.
26351212 Knockdown of Wip1 enhances sensitivity to radiation in HeLa cells by inhibiting cell proliferation and inducing apoptosis through activation of p38 MAPK.
26006237 p21 might contribute to positive regulation of WIP1, resulting in dephosphorylation of the histone H2A variant gammaH2AX.
25879755 Study reveals a mechanism of stem cell aging, in which distinct effects of p53 and mTORC1 pathways on HSC aging are governed by Wip1.
25797250 WIP1 silencing reduced expression of MMP-9, VEGF-C, cyclin D1, and c-Myc, as well as migration and invasion of salivary adenoid cystic carcinoma cells. WIP1 expression was positively associated with ACC metastasis and prognosis.
25742468 The truncating mutations of PPM1D are present in blood DNA of NSCLC patients.
25659035 ATM kinase and Wip1 phosphatase were identified as opposing regulators of DAXX-S564 phosphorylation and the role of DAXX phosphorylation and DAXX itself are independent of p53-mediated gene expression.
25658463 data suggests that WIP1 inhibition represents a novel therapeutic approach to neuroblastoma that could be integrated with current chemotherapeutic approaches
More...

AA Sequence

MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAV      1 - 70
AAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCA     71 - 140
AIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRA    141 - 210
VEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWS    211 - 280
YDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKML    281 - 350
VNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVK    351 - 420
SLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAKALTLRIHDSL    421 - 490
NNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSG    491 - 560
AQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC                             561 - 605
//

Text Mined References (101)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26847329 2016 Somatic Mosaic Mutations in PPM1D and TP53 in the Blood of Women With Ovarian Carcinoma.
26824362 2016 Squalene Inhibits ATM-Dependent Signaling in ?IR-Induced DNA Damage Response through Induction of Wip1 Phosphatase.
26714478 2016 PPM1D exerts its oncogenic properties in human pancreatic cancer through multiple mechanisms.
26351212 2014 Knockdown of Wip1 Enhances Sensitivity to Radiation in HeLa Cells Through Activation of p38 MAPK.
26006237 2015 Spontaneous ?H2AX Foci in Human Solid Tumor-Derived Cell Lines in Relation to p21WAF1 and WIP1 Expression.
25879755 2015 Wip1 deficiency impairs haematopoietic stem cell function via p53 and mTORC1 pathways.
25797250 2015 WIP1 stimulates migration and invasion of salivary adenoid cystic carcinoma by inducing MMP-9 and VEGF-C.
25742468 2015 Truncating mutations of PPM1D are found in blood DNA samples of lung cancer patients.
25659035 2015 DNA damage-induced regulatory interplay between DAXX, p53, ATM kinase and Wip1 phosphatase.
More...