Property Summary

Ligand Count 5
NCBI Gene PubMed Count 115
PubMed Score 181.77
PubTator Score 127.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 2.100 3.3e-03
invasive ductal carcinoma -1.360 7.8e-04
lung cancer -1.600 1.9e-03
osteosarcoma -3.033 4.5e-12
ovarian cancer -1.700 2.9e-04
spina bifida -1.387 4.7e-02
subependymal giant cell astrocytoma -2.105 1.3e-02

Gene RIF (104)

AA Sequence

MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAV      1 - 70
AAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCA     71 - 140
AIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRA    141 - 210
VEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWS    211 - 280
YDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKML    281 - 350
VNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVK    351 - 420
SLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAKALTLRIHDSL    421 - 490
NNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSG    491 - 560
AQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC                             561 - 605
//

Text Mined References (118)

PMID Year Title