Property Summary

Ligand Count 4
NCBI Gene PubMed Count 47
PubMed Score 55.19
PubTator Score 58.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.100 4.6e-03
cystic fibrosis -1.200 5.9e-04
esophageal adenocarcinoma -1.300 4.0e-02
facioscapulohumeral dystrophy -1.800 3.9e-02
glioblastoma 1.100 5.3e-03
lung adenocarcinoma -1.100 1.7e-02
lung cancer -3.200 2.0e-05
lung carcinoma -1.400 2.2e-07
non-small cell lung cancer -1.419 8.9e-09
ovarian cancer 1.100 8.7e-09
psoriasis -1.400 2.9e-02
sarcoidosis -1.200 3.7e-02

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (34)

AA Sequence

MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVH      1 - 70
KAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQE     71 - 140
ELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSL    141 - 210
NEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA    211 - 280
ELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDK    281 - 350
WDWLLAKTWVRNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL    351 - 420
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSE    421 - 490
IIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSAGQ    491 - 560
FDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTE    561 - 630
EAPRRSIATFQSRLAQISRGIQERNQGLVLPYTYLDPPLIENSVSI                            631 - 676
//

Text Mined References (50)

PMID Year Title