Property Summary

NCBI Gene PubMed Count 42
Grant Count 21
R01 Count 15
Funding $2,339,387.97
PubMed Score 53.76
PubTator Score 58.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
esophageal adenocarcinoma -1.300 0.040
psoriasis -1.600 0.000
glioblastoma 1.100 0.005
non-small cell lung cancer -2.166 0.000
lung cancer -3.200 0.000
sarcoidosis -1.300 0.013
cystic fibrosis -1.400 0.000
lung adenocarcinoma -1.100 0.017
inflammatory breast cancer -2.900 0.005
lung carcinoma -1.400 0.000
ovarian cancer 1.100 0.000
facioscapulohumeral dystrophy -1.800 0.039

Gene RIF (30)

PMID Text
25895668 Hpoxia-induced pulmonary vascular remodeling is associated with increased levels of 15-LO-2.
24975552 ALOX15 rs11568070 polymorphisms did not discriminate for the disease or its severity.
24732589 15-LOX2 expression inhibits Myc-induced prostate cancer development, such that in the 3-month- and 6-month-old double transgenic mice, there is a significant reduction in prostate intraneoplasia.
24533104 activated ALOX15B in macrophages may play a role in the induction of atherothrombotic events by increasing platelet aggregation and thrombin generation
24497644 Presented is the crystal structure of 15-LOX-2 in complex with an inhibitor that appears to bind as a substrate mimic. 15-LOX-2 contains a long loop, composed of hydrophobic amino acids, which projects from the amino-terminal membrane-binding domain.
24376652 Positive feedback-loop of TERT and 15-lipoxygenase-2 promotes pulmonary hypertension.
24373925 The ALOX15B gene may be associated with coronary artery disease.
22980500 ALOX15B is the mainly expressed 12/15-lipoxygenase in human macrophages and that its expression is induced by IL-4, LPS and hypoxia.
22078795 Data indicate that expressions of 15-LO-1 and 15-LO-2 in placentas and umbilical artery (HUA) rings in preeclampsia (PE) increased more than that in normal groups.
21951814 The C2-domain is not essential for catalytic activity and does hardly impact reaction specificity.
More...

AA Sequence

MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVH      1 - 70
KAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQE     71 - 140
ELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSL    141 - 210
NEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA    211 - 280
ELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDK    281 - 350
WDWLLAKTWVRNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL    351 - 420
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSE    421 - 490
IIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSAGQ    491 - 560
FDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTE    561 - 630
EAPRRSIATFQSRLAQISRGIQERNQGLVLPYTYLDPPLIENSVSI                            631 - 676
//

Text Mined References (46)

PMID Year Title
25895668 2015 Modulation of Pulmonary Vascular Remodeling in Hypoxia: Role of 15-LOX-2/15-HETE-MAPKs Pathway.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24975552 2015 Lack of association of ALOX12 and ALOX15B polymorphisms with psoriasis despite altered urinary excretion of 12(S)-hydroxyeicosatetraenoic acid.
24732589 2014 Tumor-suppressive functions of 15-Lipoxygenase-2 and RB1CC1 in prostate cancer.
24533104 2014 Arachidonate 15-lipoxygenase enzyme products increase platelet aggregation and thrombin generation.
24497644 2014 The structure of human 15-lipoxygenase-2 with a substrate mimic.
24376652 2013 Positive feedback-loop of telomerase reverse transcriptase and 15-lipoxygenase-2 promotes pulmonary hypertension.
24373925 2014 Association of polymorphisms in the ALOX15B gene with coronary artery disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22980500 2012 Expression and regulation of 12/15-lipoxygenases in human primary macrophages.
More...