Property Summary

NCBI Gene PubMed Count 70
Grant Count 77
R01 Count 54
Funding $6,421,466.71
PubMed Score 219.18
PubTator Score 81.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O15287 Protein FACG
Symbols FAG
XRCC9

Gene

 GO Function (1)

Gene RIF (33)

PMID Text
25703136 founder haplotype analysis of FANCG for the Korean Fanconi anemia population
25477267 Patients, homozygous for the FANCG founder mutation, present with severe cytopenia but progress to bone marrow failure at similar ages to other individuals affected with Fanconi anemia of heterogeneous genotype.
25132264 A new role of FANCG in Homologous recombination repair of interstrand crosslinks through K63Ub-mediated interaction with the Rap80-BRCA1 complex.
24300640 Three novel single base pair deletions, resulting in frameshift mutations (c.247delA, c.179delT and c.899delT) were identified in patients with Fanconi anaemia
23067021 FANCA and FANCG are the major Fanconi anemia genes in the Korean population.
21750350 Areca nut extracts-induced miR-23a was correlated with a reduced FANCG expression and DSB repair, which might contribute to ANE-associated human malignancies.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20518486 sites of interaction of FANCG with ERCC1, which is different from the region of ERCC1 that binds to XPF
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGLPAAVPVLPLE      1 - 70
LTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALH     71 - 140
RLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTA    141 - 210
FAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWG    211 - 280
PPLLEASRLYQQLGDTTAELESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHIL    281 - 350
ASRCLQTGRAGDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL    351 - 420
LSRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCLELLFRATPEE    421 - 490
KEQGAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLSVQMCPGNRDTYFHLLQTLKR    491 - 560
LDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLSWIRPSDRDAFLEEFRTSLPKSCDL            561 - 622
//

Text Mined References (71)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25703136 2015 Founder haplotype analysis of Fanconi anemia in the Korean population finds common ancestral haplotypes for a FANCG variant.
25477267 2015 Hematological consequences of a FANCG founder mutation in Black South African patients with Fanconi anemia.
25132264 2015 K63-linked ubiquitination of FANCG is required for its association with the Rap80-BRCA1 complex to modulate homologous recombination repair of DNA interstand crosslinks.
24300640 2013 Fanconi anaemia in black South African patients heterozygous for the FANCG c.637-643delTACCGCC founder mutation.
23067021 2013 FANCA and FANCG are the major Fanconi anemia genes in the Korean population.
22705371 2012 A ubiquitin-binding protein, FAAP20, links RNF8-mediated ubiquitination to the Fanconi anemia DNA repair network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
22343915 2012 FAAP20: a novel ubiquitin-binding FA nuclear core-complex protein required for functional integrity of the FA-BRCA DNA repair pathway.
22266823 2012 Regulation of Rev1 by the Fanconi anemia core complex.
More...