Property Summary

NCBI Gene PubMed Count 55
PubMed Score 2076.30
PubTator Score 82.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Hypertrophic Cardiomyopathy 117 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
limb-girdle muscular dystrophy 37 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.275 1.7e-06
adult high grade glioma -1.600 2.3e-05
Astrocytoma, Pilocytic -1.200 8.4e-06
atypical teratoid / rhabdoid tumor -1.500 7.1e-09
dermatomyositis -1.500 3.5e-03
glioblastoma -1.100 1.0e-06
group 4 medulloblastoma -1.100 1.3e-03
lung adenocarcinoma -1.400 1.7e-08
malignant mesothelioma 1.400 4.6e-06
medulloblastoma, large-cell -1.400 4.1e-05
primitive neuroectodermal tumor -1.100 2.0e-03

Synonym

Accession O15273 Q96L27
Symbols TELE
CMD1N
CMH25
T-cap
LGMD2G
telethonin

Gene

PDB

1YA5   2F8V  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (3)

Protein-protein Interaction (4)

Gene RIF (25)

AA Sequence

MATSELSCEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMR      1 - 70
MGILGRGLQEYQLPYQRVLPLPIFTPAKMGATKEEREDTPIQLQELLALETALGGQCVDRQEVAEITKQL     71 - 140
PPVVPVSKPGALRRSLSRSMSQEAQRG                                               141 - 167
//

Text Mined References (52)

PMID Year Title