Property Summary

Ligand Count 1
NCBI Gene PubMed Count 44
PubMed Score 143.20
PubTator Score 86.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
NEUROPATHY, HEREDITARY SENSORY AND AUTONOMIC, TYPE IA 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Neuropathy 261 4.955 2.5
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.126 1.5e-06
aldosterone-producing adenoma -1.076 1.9e-02
astrocytic glioma -1.400 3.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.115 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.1e-02
juvenile dermatomyositis 1.194 8.0e-14
medulloblastoma, large-cell -1.100 3.5e-03
Multiple myeloma 1.173 8.6e-04
ovarian cancer -1.900 1.0e-07
psoriasis -3.000 4.9e-04
tuberculosis -1.600 1.1e-04

Gene RIF (26)

AA Sequence

MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLV      1 - 70
PPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYG     71 - 140
TFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFK    141 - 210
HNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFG    211 - 280
VLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAI    281 - 350
EALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM    351 - 420
NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL                     421 - 473
//

Text Mined References (52)

PMID Year Title