Property Summary

NCBI Gene PubMed Count 77
PubMed Score 232.89
PubTator Score 230.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count
Spinocerebellar ataxia type 7 13

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.300 2.4e-02
atypical teratoid / rhabdoid tumor -1.100 6.7e-05
Breast cancer -1.300 8.0e-15
dermatomyositis 1.300 7.1e-04
glioblastoma -1.200 4.7e-05
group 3 medulloblastoma 1.300 4.5e-02
intraductal papillary-mucinous adenoma (... 1.100 1.6e-02
lung cancer -1.300 2.1e-03
non-small cell lung cancer -1.093 3.2e-18
oligodendroglioma 1.400 2.1e-03
osteosarcoma 1.110 3.8e-03
ovarian cancer -1.700 7.0e-05
pancreatic ductal adenocarcinoma liver m... 1.055 5.4e-03
Pick disease 1.100 8.9e-07
Rheumatoid arthritis 1.500 1.5e-02
spina bifida -1.540 4.7e-02

 GWAS Trait (1)

Gene RIF (55)

AA Sequence

MSERAADDVRGEPRRAAAAAGGAAAAAARQQQQQQQQQQPPPPQPQRQQHPPPPPRRTRPEDGGPGAAST      1 - 70
SAAAMATVGERRPLPSPEVMLGQSWNLWVEASKLPGKDGTELDESFKEFGKNREVMGLCREDMPIFGFCP     71 - 140
AHDDFYLVVCNDCNQVVKPQAFQSHYERRHSSSSKPPLAVPPTSVFSFFPSLSKSKGGSASGSNRSSSGG    141 - 210
VLSASSSSSKLLKSPKEKLQLRGNTRPMHPIQQSRVPHGRIMTPSVKVEKIHPKMDGTLLKSAVGPTCPA    211 - 280
TVSSLVKPGLNCPSIPKPTLPSPGQILNGKGLPAPPTLEKKPEDNSNNRKFLNKRLSEREFDPDIHCGVI    281 - 350
DLDTKKPCTRSLTCKTHSLTQRRAVQGRRKRFDVLLAEHKNKTREKELIRHPDSQQPPQPLRDPHPAPPR    351 - 420
TSQEPHQNPHGVIPSESKPFVASKPKPHTPSLPRPPGCPAQQGGSAPIDPPPVHESPHPPLPATEPASRL    421 - 490
SSEEGEGDDKEESVEKLDCHYSGHHPQPASFCTFGSRQIGRGYYVFDSRWNRLRCALNLMVEKHLNAQLW    491 - 560
KKIPPVPSTTSPISTRIPHRTNSVPTSQCGVSYLAAATVSTSPVLLSSTCISPNSKSVPAHGTTLNAQPA    561 - 630
ASGAMDPVCSMQSRQVSSSSSSPSTPSGLSSVPSSPMSRKPQKLKSSKSLRPKESSGNSTNCQNASSSTS    631 - 700
GGSGKKRKNSSPLLVHSSSSSSSSSSSSHSMESFRKNCVAHSGPPYPSTVTSSHSIGLNCVTNKANAVNV    701 - 770
RHDQSGRGPPTGSPAESIKRMSVMVNSSDSTLSLGPFIHQSNELPVNSHGSFSHSHTPLDKLIGKKRKCS    771 - 840
PSSSSINNSSSKPTKVAKVPAVNNVHMKHTGTIPGAQGLMNSSLLHQPKARP                      841 - 892
//

Text Mined References (78)

PMID Year Title