Property Summary

Ligand Count 29
NCBI Gene PubMed Count 56
PubMed Score 394.01
PubTator Score 33.36

Knowledge Summary

Patent (6,900)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cholestasis 155 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma -1.469 6.3e-03
breast carcinoma 1.100 1.7e-04
ductal carcinoma in situ 1.800 2.5e-04
interstitial cystitis -1.200 2.6e-03
intraductal papillary-mucinous adenoma (... 1.200 5.2e-04
invasive ductal carcinoma 2.300 9.7e-04
lung cancer 2.000 1.1e-03
osteosarcoma -1.219 1.0e-02
psoriasis 1.300 1.9e-11

Protein-protein Interaction (1)

Gene RIF (36)

AA Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAY      1 - 70
RELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKY     71 - 140
IHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVG    141 - 210
CIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQ    211 - 280
AADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFS    281 - 350
PIARKDSRRRSGMKL                                                           351 - 365
//

Text Mined References (66)

PMID Year Title