Property Summary

NCBI Gene PubMed Count 53
Grant Count 24
R01 Count 17
Funding $2,464,017.98
PubMed Score 317.10
PubTator Score 33.36

Knowledge Summary

Patent (6,900)

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.219 0.010
adrenocortical carcinoma -1.469 0.006
intraductal papillary-mucinous adenoma (... 1.200 0.001
lung cancer 2.000 0.001
breast carcinoma 1.100 0.000
interstitial cystitis -1.200 0.003
psoriasis 1.300 0.000
ductal carcinoma in situ 1.800 0.000
invasive ductal carcinoma 2.300 0.001

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (33)

PMID Text
26969274 MAPK13 gene knockdown using siRNA reduced the aldehyde dehydrogenase high cell population and abrogated the tumor-initiating ability.
26843485 p38gamma and p38delta reprogram liver metabolism by modulating neutrophil infiltration and provide a potential target for NAFLD therapy
26270987 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
26075907 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
25849390 MAPK13 undergoes a larger interlobe configurational rearrangement upon activation compared with MAPK14.
24658403 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
24599959 PKCdelta activates a MEKK1/MEK3/p38delta MAPK cascade to increase p53 levels and p53 drives p21(Cip1) gene expression.
24447338 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
24244375 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
24225433 p38-MAPK13 (delta isoform of p38-MAPK) is involved in Vpr-mediated IL6 induction in astrocytes
More...

AA Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAY      1 - 70
RELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKY     71 - 140
IHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVG    141 - 210
CIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQ    211 - 280
AADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFS    281 - 350
PIARKDSRRRSGMKL                                                           351 - 365
//

Text Mined References (63)

PMID Year Title
26969274 2016 MAPK13 is preferentially expressed in gynecological cancer stem cells and has a role in the tumor-initiation.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26843485 2016 p38? and p38? reprogram liver metabolism by modulating neutrophil infiltration.
25849390 2015 The crystal structure of phosphorylated MAPK13 reveals common structural features and differences in p38 MAPK family activation.
24599959 2014 p38? regulates p53 to control p21Cip1 expression in human epidermal keratinocytes.
23878395 2013 Induction of p38? expression plays an essential role in oncogenic ras-induced senescence.
23798682 2013 An unbiased approach to identifying tau kinases that phosphorylate tau at sites associated with Alzheimer disease.
23722928 2013 Loss of p38? mitogen-activated protein kinase expression promotes oesophageal squamous cell carcinoma proliferation, migration and anchorage-independent growth.
23590314 2013 Genome-wide promoter methylation analysis identifies epigenetic silencing of MAPK13 in primary cutaneous melanoma.
23187130 2012 IL-13-induced airway mucus production is attenuated by MAPK13 inhibition.
More...