Property Summary

NCBI Gene PubMed Count 251
PubMed Score 88.34
PubTator Score 517.35

Knowledge Summary

Patent

No data available

Gene RIF (236)

AA Sequence

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP            1 - 64
//

Text Mined References (251)

PMID Year Title