Property Summary

NCBI Gene PubMed Count 233
Grant Count 136
R01 Count 69
Funding $18,790,227.75
PubMed Score 87.06
PubTator Score 517.35

Knowledge Summary

Patent

No data available

Synonym

Accession O15263 Q52LC0
Symbols BD-2
SAP1
DEFB2
DEFB4
HBD-2
DEFB-2
DEFB102

Gene

PDB

1E4Q   1FD3   1FD4   1FQQ  

Gene RIF (217)

PMID Text
26950997 In periodontitis, TLR2 gene hyperexpression was accompanied by the reduction of expression of anti-microbial peptide HBD-2, as well as in an increase of production of TNF-alpha and TGF-beta by epithelial cells of periodontium mucosa.
26773532 EMMPRIN, MMP8, hyaluronan, beta-defensing-2, and neutrophil gelatinase-associated lipocalin (NGAL) are elevated in women with vaginal inflammation
26539799 HBD2 or HBD3 cointernalized with virions in endosomes, formed oligomers, and reduced infectivity of human immunodeficiency virus.
26536271 Study found that HBD2 bound tightly to Mc1r with an affinity similar to that of HBD3
26448160 human lung epithelial cells secrete CCL20 and BD2 in response to B. abortus and/or to cytokines produced by infected monocytes.
26434201 A higher frequency of a lower (<4) copy number of the DEFB4 gene was observed in patients with Multiple Sclerosis as compared with the controls.
26350435 BD2 secreted by the mesenchymal stem cells via TLR- 4 signalling pathway is one of the critical paracrine factors mediating microbicidal effects against E. coli.
26244639 Methylglyoxal and glyoxal in vitro irreversibly adduct to the recombinant human BD-2 peptide, and significantly reduce antimicrobial and chemotactic functions.
26038828 there is a significant link between innate immunity deregulation through disruption of cationic peptides (hBDs) and the potential development of colon cancer.
26025437 The copy numbers of DEFB4 gene may be associated with ankylosing spondylitis and involved in disease progression.
More...

AA Sequence

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP            1 - 64
//

Text Mined References (233)

PMID Year Title
26950997 [STUDY OF THE ROLE OF INNATE IMMUNITY FACTORS (TLR2, HBD-2, TNF-?, TGF-?) IN PERIODONTITIS PATHOGENESIS].
26773532 2016 Vaginal Inflammation: Association between Leukocyte Concentration and Levels of Immune Mediators.
26539799 2016 Human beta-defensins 2 and -3 cointernalize with human immunodeficiency virus via heparan sulfate proteoglycans and reduce infectivity of intracellular virions in tonsil epithelial cells.
26536271 2015 Electrostatic Similarity Analysis of Human ?-Defensin Binding in the Melanocortin System.
26448160 2015 CCL20 and Beta-Defensin 2 Production by Human Lung Epithelial Cells and Macrophages in Response to Brucella abortus Infection.
26434201 2015 GENETIC POLYMORPHISMS OF HUMAN ?-DEFENSINS IN PATIENTS WITH MULTIPLE SCLEROSIS.
26350435 2016 Antibacterial effect of mesenchymal stem cells against Escherichia coli is mediated by secretion of beta- defensin- 2 via toll- like receptor 4 signalling.
26244639 2015 Modification of ?-Defensin-2 by Dicarbonyls Methylglyoxal and Glyoxal Inhibits Antibacterial and Chemotactic Function In Vitro.
26038828 2015 Expression and new exon mutations of the human Beta defensins and their association on colon cancer development.
26025437 2016 Association of ?-defensin gene copy number variations with ankylosing spondylitis in Chinese population: A case-control study.
More...