Property Summary

NCBI Gene PubMed Count 251
PubMed Score 88.34
PubTator Score 517.35

Knowledge Summary

Patent

No data available

Synonym

Accession O15263 Q52LC0
Symbols BD-2
SAP1
DEFB2
DEFB4
HBD-2
DEFB-2
DEFB102

Gene

PDB

1E4Q   1FD3   1FD4   1FQQ  

  Ortholog (1)

Species Source Disease
Rat OMA EggNOG

Gene RIF (236)

AA Sequence

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP            1 - 64
//

Text Mined References (251)

PMID Year Title