Property Summary

NCBI Gene PubMed Count 19
Grant Count 10
R01 Count 4
Funding $1,835,508.66
PubMed Score 16.56
PubTator Score 3.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with surfeit 4 (SURF4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18287528 Silencing Surf4 together with ERGIC-53 or silencing the p24 family member p25 induced an identical phenotype characterized by a reduced number of ERGIC clusters and fragmentation of the Golgi apparatus without effect on anterograde transport.

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFV      1 - 70
FLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKS     71 - 140
MFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVV    141 - 210
WLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW               211 - 269
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18287528 2008 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...