Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.65
PubTator Score 3.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (5)

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFV      1 - 70
FLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKS     71 - 140
MFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVV    141 - 210
WLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW               211 - 269
//

Text Mined References (24)

PMID Year Title