Property Summary

NCBI Gene PubMed Count 13
PubMed Score 39.95
PubTator Score 35.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.200 1.2e-03
glioblastoma 1.700 5.1e-04
Multiple myeloma 1.224 7.7e-05
non primary Sjogren syndrome sicca 1.200 2.2e-02
ovarian cancer 2.400 4.3e-06
pediatric high grade glioma 1.100 1.7e-06
psoriasis -1.800 1.7e-04

Gene RIF (8)

AA Sequence

MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYA      1 - 70
LGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDA     71 - 140
FNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFAS                  141 - 196
//

Text Mined References (25)

PMID Year Title