Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.46
PubTator Score 3.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAP      1 - 70
GSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILP     71 - 140
TDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA     141 - 209
//

Text Mined References (10)

PMID Year Title