Property Summary

NCBI Gene PubMed Count 24
PubMed Score 30.07
PubTator Score 18.32

Knowledge Summary

Patent (625)

TINX Plot

  Disease (6)

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -4.000 2.8e-05
cystic fibrosis -1.200 9.0e-05
interstitial cystitis 1.300 9.4e-04
intraductal papillary-mucinous adenoma (... -2.100 1.5e-04
intraductal papillary-mucinous carcinoma... -2.200 1.9e-04
intraductal papillary-mucinous neoplasm ... -2.200 2.1e-03
lung cancer -1.900 7.2e-04
lung carcinoma -2.500 2.1e-28
non-small cell lung cancer -1.804 1.6e-18
oligodendroglioma -1.100 1.3e-02
osteosarcoma -1.470 2.4e-02
ovarian cancer -1.200 1.8e-05
primary Sjogren syndrome 1.800 1.0e-04
spina bifida -1.602 3.2e-02
ulcerative colitis 2.300 2.1e-06

Gene RIF (5)

AA Sequence

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP      1 - 70
PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL     71 - 140
KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS    141 - 210
GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS                                     211 - 247
//

Text Mined References (26)

PMID Year Title