Property Summary

NCBI Gene PubMed Count 24
PubMed Score 26.26
PubTator Score 18.32

Knowledge Summary

Patent (625)

Expression

  Differential Expression (15)

Synonym

Accession O15247 A8K9S0 O15174 Q5JT80 Q8TCE3
Symbols CLIC2b
MRXS32
XAP121

Gene

PDB

2PER   2R4V   2R5G  

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model

Gene RIF (5)

PMID Text
22814392 a vital role for the CLIC2 protein in maintaining normal cognitive function via its interaction with RyRs in the brain.
18186468 crystal structure of soluble human CICL2 and implications for function
18007051 Human CLIC2 was crystallized in 2 different forms, in presence of GSSH. Form A displayed P2(1)2(1)2(1) symmetry, with unit-cell parameters a=44.0, b=74.7, c=79.8 A. Form B displayed P2(1) symmetry, with unit-cell parameters a=36.0, b=66.9, c=44.1 A.
17945253 CLIC2 forms pH-dependent chloride channels in vitro with higher channel activity at low pH levels and that the channels are subject to redox regulation
15147738 CLIC2 inhibited cardiac ryanodine receptor Ca2+ release channels in lipid bilayers when added to the cytoplasmic side of the channels and inhibited Ca2+ release from cardiac sarcoplasmic reticulum vesicles

AA Sequence

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP      1 - 70
PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL     71 - 140
KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS    141 - 210
GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS                                     211 - 247
//

Text Mined References (26)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23871722 2013 XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing.
22814392 2012 An X-linked channelopathy with cardiomegaly due to a CLIC2 mutation enhancing ryanodine receptor channel activity.
21630357 2011 A missense mutation in CLIC2 associated with intellectual disability is predicted by in silico modeling to affect protein stability and dynamics.
21357393 2011 Refinement of the X-linked nonsyndromic high-grade myopia locus MYP1 on Xq28 and exclusion of 13 known positional candidate genes by direct sequencing.
21269460 2011 Initial characterization of the human central proteome.
18186468 2008 The crystal structure of human chloride intracellular channel protein 2: a disulfide bond with functional implications.
18007051 2007 Expression, purification, crystallization and preliminary X-ray diffraction analysis of chloride intracellular channel 2 (CLIC2).
17945253 2007 Structure of the Janus protein human CLIC2.
16381901 2006 The LIFEdb database in 2006.
More...