Property Summary

NCBI Gene PubMed Count 115
Grant Count 16
R01 Count 13
Funding $1,070,146.33
PubMed Score 138.00
PubTator Score 484.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.948 0.007

Gene RIF (107)

PMID Text
26872727 This study indicates a promising role for intratumoral OCT1 mRNA expression as a prognostic biomarker in therapeutic algorithms in HCC
26657401 Data show that bisindolylmaleimides (BIMs) Ro 31-8220 also blocks activity of the solute carrier organic cation transporter 1 (OCT1), involved in uptake of marketed drugs in the liver, in a protein kinase C (PKC)-independent manner.
26546461 Data indicate no association was found between genotypes of drug transporters ABCB1, ABCG2, OCT1 genetic polymorphisms and the occurrence of thrombocytopenia.
26354214 A positive association was observed between the expression of the ABCB1 and ABCG2 transporter genes (r=0.407, P<0.05) while no association was observed between the expression of either of the ABC transporter genes with the OCT1 gene
25883089 Findings suggest specific involvement of each organic cation transporters (OCT1-3) in drug transportation.
25753371 Homozygous carriers of the polymorphic OCT1 C-allele had no metformin-related toxicity as compared with 41.9% for any metformin-related toxicity in carriers of at least one wild-type A-allele
25582574 hOCT1 is a suitable bendamustine transporter, thereby contributing to its cytotoxic effect depending upon the hOCT1 genetic variants expressed
25358338 The hOCT1 expression level can be an important predictor in CML patients treated with IM.
25155932 Our data suggest that besides bodyweight, OCT1 and ABCC3 genotypes play a significant role in the pharmacokinetics of intravenous morphine and its metabolites in children
24780098 Nucleoside transporters and human OCT1 determine the cellular handling of DNA-methyltransferase inhibitors
More...

AA Sequence

MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEEL      1 - 70
NYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNL     71 - 140
VCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQG    141 - 210
LVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYW    211 - 280
CVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL    281 - 350
MYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM    351 - 420
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREV    421 - 490
WQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT          491 - 554
//

Text Mined References (125)

PMID Year Title
26872727 2016 Organic Cation Transporter 1 (OCT1) mRNA expression in hepatocellular carcinoma as a biomarker for sorafenib treatment.
26657401 2015 Protein Kinase C-Independent Inhibition of Organic Cation Transporter 1 Activity by the Bisindolylmaleimide Ro 31-8220.
26546461 2015 A study to explore the correlation of ABCB1, ABCG2, OCT1 genetic polymorphisms and trough level concentration with imatinib mesylate-induced thrombocytopenia in chronic myeloid leukemia patients.
26354214 2015 Molecular response to imatinib & its correlation with mRNA expression levels of imatinib influx & efflux transporters in patients with chronic myeloid leukaemia in chronic phase.
25883089 2015 Functional characterization of the organic cation transporters (OCTs) in human airway pulmonary epithelial cells.
25753371 2015 Multidrug and toxin extrusion 1 and human organic cation transporter 1 polymorphisms in patients with castration-resistant prostate cancer receiving metformin (SAKK 08/09).
25582574 2015 Human organic cation transporter 1 (hOCT1) as a mediator of bendamustine uptake and cytotoxicity in chronic lymphocytic leukemia (CLL) cells.
25358338 2015 Human organic cation transporter 1 protein levels of granulocytes can optimize imatinib therapy in patients with chronic myeloid leukemia.
25155932 2014 ABCC3 and OCT1 genotypes influence pharmacokinetics of morphine in children.
24816252 2014 An atlas of genetic influences on human blood metabolites.
More...