Property Summary

NCBI Gene PubMed Count 86
Grant Count 68
R01 Count 40
Funding $7,030,412.59
PubMed Score 124.30
PubTator Score 170.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.150 0.021
malignant mesothelioma -4.200 0.000
osteosarcoma 1.000 0.000

Synonym

Accession O15244 Q5T7Q6 Q6PIQ8 Q8NG62 Q9NQB9
Symbols OCT2

Gene

Gene RIF (81)

PMID Text
26674735 Seventeen of the variants observed in the SLC22A2 gene of the Xhosa population were specific to/or occurred at a higher frequency in African populations or populations with a recent connection to the African continent.
25883089 Findings suggest specific involvement of each organic cation transporters (OCT1-3) in drug transportation.
25823781 We noted a statistically significant association between the nonsynonymous SNP rs316019(SLC22A2) and cisplatin-induced ototoxicity, in that the T allele occurred more frequently in patients who experienced no ototoxicity from cisplatin treatment.
25662675 the loss-of-function variant OCT2-T201M (rs145450955) contribute to changes in insulin resistance and beta cell activity in patients with T2D treated with metformin.
25573751 The 808G>T variant of SLC22A2 improves the metformin long-term glucose-lowering effect in Chinese type 2 diabetics.
25143296 The functional OCT2 Ser270Ala polymorphism is significantly associated with abstinence among treatment-seeking smokers.
25019617 functional amino acid residues involved in polyamine and agmatine transport by human organic cation transporter 2
24643204 The genetic polymorphisms in OCT2, AQP2, AQP9 and TMEM205 may contribute to chemotherapy response in lung cancer patients.
24533710 OCT variants ( OCT1, OCT2 and ATM) were significantly associated with elevated baseline and glucose-induced C-peptide levels in polycystic ovary syndrome
24530383 Clopidogrel/clopidogrel carboxylate are weak inhibitors of OCT2.
More...

AA Sequence

MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAEE      1 - 70
LNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFN     71 - 140
LVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQ    141 - 210
GLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYY    211 - 280
WCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMI    281 - 350
LMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA    351 - 420
SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTN    421 - 490
IWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN         491 - 555
//

Text Mined References (99)

PMID Year Title
26674735 2015 Single nucleotide polymorphisms of the SLC22A2 gene within the Xhosa population of South Africa.
25883089 2015 Functional characterization of the organic cation transporters (OCTs) in human airway pulmonary epithelial cells.
25823781 2015 Human OCT2 variant c.808G>T confers protection effect against cisplatin-induced ototoxicity.
25662675 2015 The variant organic cation transporter 2 (OCT2)-T201M contribute to changes in insulin resistance in patients with type 2 diabetes treated with metformin.
25573751 2015 Polymorphism of organic cation transporter 2 improves glucose-lowering effect of metformin via influencing its pharmacokinetics in Chinese type 2 diabetic patients.
25143296 2014 Organic cation transporter variation and response to smoking cessation therapies.
25019617 2014 Identification of functional amino acid residues involved in polyamine and agmatine transport by human organic cation transporter 2.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24643204 2014 The association of transporter genes polymorphisms and lung cancer chemotherapy response.
24533710 2014 Metformin resistance alleles in polycystic ovary syndrome: pattern and association with glucose metabolism.
More...