Property Summary

NCBI Gene PubMed Count 29
PubMed Score 150.72
PubTator Score 69.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Stomach Ulcer 18 0.0 0.0
Disease Target Count P-value
ependymoma 4679 2.0e-05
lung cancer 4740 7.7e-04
Astrocytoma, Pilocytic 3081 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Obesity 678 3.036 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 1.2e-02
ependymoma -1.300 2.0e-05
lung cancer 1.100 7.7e-04

Gene RIF (23)

AA Sequence

MKALRLSASALFCLLLINGLGAAPPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVRGARNSEPQDE      1 - 70
GELFQGVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVRSQTHSLPAPESPEPAAPPRP     71 - 140
QTPENGPEASDPSEELEALASLLQELRDFSPSSAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASW    141 - 210
GEFQARVPERAPLPPPAPSQFQARMPDSGPLPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKAR    211 - 280
RPESALLGGSEAGERLLQQGLAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRG    281 - 350
LQEAAEERESAREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRS    351 - 420
QEETPGHRRKEAEGTEEGGEEEDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEP    421 - 490
VPPPRAAPAPTHVRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSA    491 - 560
LRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHVLLRRP                   561 - 615
//

Text Mined References (34)

PMID Year Title