Property Summary

NCBI Gene PubMed Count 27
Grant Count 55
R01 Count 44
Funding $5,646,056.4
PubMed Score 141.15
PubTator Score 69.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma -1.600 0.000
lung cancer 1.100 0.001
pilocytic astrocytoma 1.300 0.007

 GO Function (1)

Gene RIF (21)

PMID Text
26562304 Data show that two VGF peptides (NAPP-19 and QQET-30) were identified in plasma.
26337083 Data show although no any significant differences between patient groups and lean subjects of proteins SYT4, BAG3, APOA1, and VAV3, except for VGF protein, there was a trend between the expression of these four genes and their protein levels.
26142708 Data indicate an increased number of neurosecretory protein VGF-expressing T cells in patients with Alzheimer's disease (AD) compared to aged healthy controls.
25675362 Knock-in mice expressing human VGF were fertile, had increased body weight, whereas those with c-terminal region deletion had reduced adiposity, increased energy expenditure, and improved glucose tolerance.
25569790 Results indicate that neuron-restrictive silencer factor plays an important role as a repressor of VGF gene regulation in neuroblastoma cells through a mechanism that is dependent on VGF-neuron-restrictive silencer element
25529453 NERPs may be potent endogenous suppressors of glucose-dependent insulin secretion.
25013207 We conclude that VGF contributes to survival and function of peripheral T cells
24934694 DISC1 knockdown leads to a reduction of VGF in neurons.
24830820 Among the 19 genes tested, VGF was found to be completely methylated in several Urothelial Cell Carcinoma cell lines
24086249 results indicate that VGF and PGP9.5 PH are potential biomarkers for ovarian carcinoma
More...

AA Sequence

MKALRLSASALFCLLLINGLGAAPPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVRGARNSEPQDE      1 - 70
GELFQGVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVRSQTHSLPAPESPEPAAPPRP     71 - 140
QTPENGPEASDPSEELEALASLLQELRDFSPSSAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASW    141 - 210
GEFQARVPERAPLPPPAPSQFQARMPDSGPLPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKAR    211 - 280
RPESALLGGSEAGERLLQQGLAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRG    281 - 350
LQEAAEERESAREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRS    351 - 420
QEETPGHRRKEAEGTEEGGEEEDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEP    421 - 490
VPPPRAAPAPTHVRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSA    491 - 560
LRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHVLLRRP                   561 - 615
//

Text Mined References (32)

PMID Year Title
26562304 2015 VGF Peptide Profiles in Type 2 Diabetic Patients' Plasma and in Obese Mice.
26337083 2015 Age-related obesity and type 2 diabetes dysregulate neuronal associated genes and proteins in humans.
26142708 2015 VGF expression by T lymphocytes in patients with Alzheimer's disease.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25675362 2015 Role of VGF-derived carboxy-terminal peptides in energy balance and reproduction: analysis of "humanized" knockin mice expressing full-length or truncated VGF.
25569790 2015 Transcriptional regulation of the neuropeptide VGF by the neuron-restrictive silencer factor/neuron-restrictive silencer element.
25529453 2015 Chronic effects of neuroendocrine regulatory peptide (NERP-1 and -2) on insulin secretion and gene expression in pancreatic ?-cells.
25013207 2014 Age-related increase of VGF-expression in T lymphocytes.
24934694 2014 Neuropeptide precursor VGF is genetically associated with social anhedonia and underrepresented in the brain of major mental illness: its downregulation by DISC1.
24830820 2014 Epigenetic inactivation of VGF associated with Urothelial Cell Carcinoma and its potential as a non-invasive biomarker using urine.
More...