Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.03
PubTator Score 11.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession O15235 Q53X98 MRP-S12
Symbols RPS12
RPMS12
RPSM12
MPR-S12
MT-RPS12

Gene

PDB

3J9M  

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19439209 NF-Y type CCAAT boxes are found preferentially in bidirectional Mrps12/Sarsm promoters, but many such promoters lack them and must be regulated in another way.
18854154 Knockdown of mitochondrial ribosomal protein S12 (MRPS12) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18790094 mitochondrial ribosomal protein S12 3'-UTR interacts specifically with TRAP1 (tumor necrosis factor receptor-associated protein1), hnRNPM4 (heterogeneous nuclear ribonucleoprotein M4), Hsp70 and Hsp60 (heat shock proteins 70 and 60), and alpha-tubulin
12706105 Homo sapiens mitochondrial ribosomal protein S12

AA Sequence

MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKP      1 - 70
KKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK       71 - 138
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19439209 2009 NF-Y influences directionality of transcription from the bidirectional Mrps12/Sarsm promoter in both mouse and human cells.
18790094 2008 cis-acting sequences and trans-acting factors in the localization of mRNA for mitochondrial ribosomal proteins.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12970870 2003 Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
More...