Property Summary

NCBI Gene PubMed Count 28
Grant Count 7
R01 Count 6
Funding $480,540.19
PubMed Score 180.16
PubTator Score 20.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma 1.400 0.004
psoriasis -1.300 0.002
osteosarcoma -1.396 0.000
medulloblastoma, large-cell 1.100 0.000
group 4 medulloblastoma 1.100 0.000

 MGI Term (1)

Gene RIF (6)

PMID Text
23530232 MLN51, alone or as part of the EJC, interacts directly with the pivotal eukaryotic translation initiation factor eIF3
22190034 HIV-1 gp120 is identified to have a physical interaction with cancer susceptibility candidate 3 (CASC3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21327427 MLN51 is a key factor in fibroblast-like synoviocyte hyperplasia of rheumatoid arthritis patients.
17652158 MLN51 is recruited into cytoplasmic aggregates known as stress granules (SGs) together with the SG-resident proteins.
16931718 crystal structure of a tetrameric exon junction core complex containing the DEAD-box adenosine triphosphatase eukaryotic initiation factor 4AIII bound to an ATP analog, MAGOH, Y14, a fragment of MLN51, and a polyuracil mRNA mimic
15166247 data demonstrate that metastatic lymph node(MLN)51 protein associates with exon junction complex in the nucleus and remains stably associated with messenger RNA in the cytoplasm

AA Sequence

MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALHLRRVESGGAK      1 - 70
SAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKS     71 - 140
TVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRK    141 - 210
LWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNK    211 - 280
SHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYR    281 - 350
SRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKL    351 - 420
AEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELR    421 - 490
GMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTH    491 - 560
GDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNF    561 - 630
GNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSR    631 - 700
GSS                                                                       701 - 703
//

Text Mined References (39)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23530232 2013 EJC core component MLN51 interacts with eIF3 and activates translation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084401 2012 The cellular EJC interactome reveals higher-order mRNP structure and an EJC-SR protein nexus.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21478859 2011 RNF146 is a poly(ADP-ribose)-directed E3 ligase that regulates axin degradation and Wnt signalling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21327427 2011 Metastatic lymph node 51 and fibroblast-like synoviocyte hyperproliferation in rheumatoid arthritis pathogenesis.
21269460 2011 Initial characterization of the human central proteome.
More...