Property Summary

NCBI Gene PubMed Count 42
PubMed Score 210.46
PubTator Score 92.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma 1.100 2.5e-17
ductal carcinoma in situ 1.200 1.1e-02
invasive ductal carcinoma 1.462 1.6e-03
lung adenocarcinoma -1.100 2.6e-08
lung cancer 1.700 7.5e-04
lung carcinoma -1.400 4.8e-09
malignant mesothelioma -2.900 2.1e-07
non primary Sjogren syndrome sicca -1.100 2.3e-02
ovarian cancer 1.700 9.2e-03
pancreatic cancer 1.500 6.5e-03
psoriasis -1.300 8.8e-04

Protein-protein Interaction (3)

Gene RIF (29)

AA Sequence

MPRPAPARRLPGLLLLLWPLLLLPSAAPDPVARPGFRRLETRGPGGSPGRRPSPAAPDGAPASGTSEPGR      1 - 70
ARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTRVAVVNYASTVKIEFQLQAY     71 - 140
TDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGAREPSSNIPKVAIIVTDGRPQDQVNEVAARA    141 - 210
QASGIELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCI    211 - 280
SDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQD    281 - 350
KCALGTHGCQHICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPG    351 - 420
YTLNEDKKTCSATEEARRLVSTEDACGCEATLAFQDKVSSYLQRLNTKLDDILEKLKINEYGQIHR        421 - 486
//

Text Mined References (46)

PMID Year Title