Property Summary

NCBI Gene PubMed Count 40
Grant Count 33
R01 Count 29
Funding $5,340,870.56
PubMed Score 198.78
PubTator Score 92.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -2.900 0.000
psoriasis -1.300 0.001
lung cancer 3.600 0.000
pancreatic cancer 1.500 0.007
lung adenocarcinoma -1.500 0.000
non primary Sjogren syndrome sicca -1.100 0.023
invasive ductal carcinoma 1.462 0.002
lung carcinoma -1.400 0.000
breast carcinoma 1.100 0.000
ductal carcinoma in situ 1.200 0.011
ovarian cancer 1.700 0.009

Gene RIF (27)

PMID Text
25331953 MATN3 may have the inherent ability to inhibit premature chondrocyte hypertrophy by suppressing BMP-2/Smad1 activity
24934313 This report is the first to show the involvement of MATN3 in C-type natriuretic peptide/natriuretic peptide receptor-B signaling pathway during the process of transforming growth factor-beta induced chondrogenic differentiation of mesenchymal stem cells.
23523902 The VWA1 domain of matrilin-3 is primarily responsible for the induction of IL-6 release from primary human chondrocytes.
22973175 Polymorphism in the MATN3 gene might play a role in osteoarthritis in the Chinese Han population.
22967398 MATN3 plays a regulatory role in cartilage homeostasis due to its capacity to induce IL-1Ra, upregulate gene expression of major cartilage matrix components, and downregulate the expression of OA-associated matrix-degrading proteinases in chondrocytes.
22270056 Haplotype-4 of MATN3 is associated with vertebral fracture risk independent of bone mineral density in Chinese postmenopausal women.
21965141 Radiographic findings in patients with COMP and MATN3 mutations showed marked abnormalities in hip and knee joints.
21922596 MATN3 mutations were identified in 13 multiple epiphyseal dysplasia patients and comprised predominantly of missense mutations.
20237151 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPRPAPARRLPGLLLLLWPLLLLPSAAPDPVARPGFRRLETRGPGGSPGRRPSPAAPDGAPASGTSEPGR      1 - 70
ARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTRVAVVNYASTVKIEFQLQAY     71 - 140
TDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGAREPSSNIPKVAIIVTDGRPQDQVNEVAARA    141 - 210
QASGIELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCI    211 - 280
SDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQD    281 - 350
KCALGTHGCQHICVNDRTGSHHCECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPG    351 - 420
YTLNEDKKTCSATEEARRLVSTEDACGCEATLAFQDKVSSYLQRLNTKLDDILEKLKINEYGQIHR        421 - 486
//

Text Mined References (44)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25416956 2014 A proteome-scale map of the human interactome network.
25331953 2014 Matrilin-3 inhibits chondrocyte hypertrophy as a bone morphogenetic protein-2 antagonist.
24934313 2014 Matrilin-3 as a putative effector of C-type natriuretic peptide signaling during TGF-? induced chondrogenic differentiation of mesenchymal stem cells.
23523902 2013 The matrilin-3 VWA1 domain modulates interleukin-6 release from primary human chondrocytes.
22973175 2012 MATN3 gene polymorphism is associated with osteoarthritis in Chinese Han population: a community-based case-control study.
22967398 2012 Matrilin-3 induction of IL-1 receptor antagonist is required for up-regulating collagen II and aggrecan and down-regulating ADAMTS-5 gene expression.
22270056 2012 A haplotype of MATN3 is associated with vertebral fracture in Chinese postmenopausal women: Peking Vertebral Fracture (PK-VF) study.
21965141 2011 Revisit of multiple epiphyseal dysplasia: ethnic difference in genotypes and comparison of radiographic features linked to the COMP and MATN3 genes.
21922596 2012 Pseudoachondroplasia and multiple epiphyseal dysplasia: a 7-year comprehensive analysis of the known disease genes identify novel and recurrent mutations and provides an accurate assessment of their relative contribution.
More...