Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.27
PubTator Score 52.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.846 2.6e-03
atypical teratoid / rhabdoid tumor 1.100 2.0e-02
ependymoma 1.600 2.6e-04
esophageal adenocarcinoma -3.200 2.2e-02
interstitial cystitis -1.200 6.3e-03
intraductal papillary-mucinous adenoma (... 2.300 4.8e-02
lung cancer -2.700 1.2e-05
lung carcinoma -1.100 1.8e-26
malignant mesothelioma 1.600 3.1e-07
nasopharyngeal carcinoma -1.500 8.5e-06
osteosarcoma -2.042 1.4e-03
pancreatic cancer 1.100 3.8e-03
pancreatic carcinoma 1.100 3.8e-03
spina bifida -1.914 4.0e-02
tuberculosis 1.100 7.1e-04

Gene RIF (5)

AA Sequence

MSISALGGRTKGKPLPPGEEERNNVLKQMKVRTTLKGDKSWITKQDESEGRTIELPSGRSRATSFSSAGE      1 - 70
VPKPRPPSTRAPTGYIIRGVFTKPIDSSSQPQQQFPKANGTPKSAASLVRTANAGPPRPSSSGYKMTTED     71 - 140
YKKLAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREHSYVLSAAKKSTGPTQET    141 - 210
QAPFIAKRVEVVEEDGPSEKSQDPPALARSTPGSNSADGGRTKASRAIWIECLPSMPSPAGSQELSSRGE    211 - 280
EIVRLQILTPRAGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLAGEEAFRAPNTDAARSSAQLSDGNV    281 - 350
GSGATGSRPEGLAAVDIGSERGSSSATSVSAVPADRKSNSTAAQEDAKADPKGALADYEGKDVATRVGEA    351 - 420
WQERPGAPRGGQGDPAVPAQQPADPSTPERQSSPSGSEQLVRRESCGSSVLTDFEGKDVATKVGEAWQDR    421 - 490
PGAPRGGQGDPAVPTQQPADPSTPEQQNSPSGSEQFVRRESCTSRVRSPSSCMVTVTVTATSEQPHIYIP    491 - 560
APASELDSSSTTKGILFVKEYVNASEVSSGKPVSARYSNVSSIEDSFAMEKKPPCGSTPYSERTTGGICT    561 - 630
YCNREIRDCPKITLEHLGICCHEYCFKCGICSKPMGDLLDQIFIHRDTIHCGKCYEKLF               631 - 689
//

Text Mined References (15)

PMID Year Title