Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.98
PubTator Score 52.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.100 0.004
malignant mesothelioma 1.600 0.000
esophageal adenocarcinoma -3.200 0.022
osteosarcoma -2.042 0.001
ependymoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.100 0.020
adrenocortical carcinoma -1.846 0.003
tuberculosis 1.100 0.001
intraductal papillary-mucinous adenoma (... 2.300 0.048
lung cancer -2.700 0.000
interstitial cystitis -1.600 0.000
pancreatic carcinoma 1.100 0.004
nasopharyngeal carcinoma -1.500 0.000
lung carcinoma -1.100 0.000
spina bifida -1.914 0.040

Gene RIF (3)

PMID Text
16799630 ZNF185 may function as a tumor-suppressor protein by associating with the actin-cytoskeleton
15731117 transcriptional activation of ZNF185 and CYP3A4 is mediated by direct association of BRG1 with their promoters and a decreased level of ZNF185 is a common feature of lung tumours
12873976 Transcriptional silencing of ZNF185 by methylation in prostate tumor tissues implicates the ZNF185 gene in prostate tumorigenesis.

AA Sequence

MSISALGGRTKGKPLPPGEEERNNVLKQMKVRTTLKGDKSWITKQDESEGRTIELPSGRSRATSFSSAGE      1 - 70
VPKPRPPSTRAPTGYIIRGVFTKPIDSSSQPQQQFPKANGTPKSAASLVRTANAGPPRPSSSGYKMTTED     71 - 140
YKKLAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREHSYVLSAAKKSTGPTQET    141 - 210
QAPFIAKRVEVVEEDGPSEKSQDPPALARSTPGSNSADGGRTKASRAIWIECLPSMPSPAGSQELSSRGE    211 - 280
EIVRLQILTPRAGLRLVAPDVEGMRSSPGNKDKEAPCSRELQRDLAGEEAFRAPNTDAARSSAQLSDGNV    281 - 350
GSGATGSRPEGLAAVDIGSERGSSSATSVSAVPADRKSNSTAAQEDAKADPKGALADYEGKDVATRVGEA    351 - 420
WQERPGAPRGGQGDPAVPAQQPADPSTPERQSSPSGSEQLVRRESCGSSVLTDFEGKDVATKVGEAWQDR    421 - 490
PGAPRGGQGDPAVPTQQPADPSTPEQQNSPSGSEQFVRRESCTSRVRSPSSCMVTVTVTATSEQPHIYIP    491 - 560
APASELDSSSTTKGILFVKEYVNASEVSSGKPVSARYSNVSSIEDSFAMEKKPPCGSTPYSERTTGGICT    561 - 630
YCNREIRDCPKITLEHLGICCHEYCFKCGICSKPMGDLLDQIFIHRDTIHCGKCYEKLF               631 - 689
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16799630 2007 ZNF185, an actin-cytoskeleton-associated growth inhibitory LIM protein in prostate cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15731117 2005 Transcriptional targets of the chromatin-remodelling factor SMARCA4/BRG1 in lung cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...