Property Summary

NCBI Gene PubMed Count 22
Grant Count 28
R01 Count 18
Funding $6,298,591.68
PubMed Score 104.92
PubTator Score 63.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

 GWAS Trait (1)

Gene RIF (13)

PMID Text
26099564 These results suggest that KMO exhibits tumor-promoting effects towards hepatocellular carcinoma (HCC) and it may serve as a novel prognostic marker in HCC.
25715464 Two KMO SNPs were observed more often in schizophrenia patient group compared with healthy controls.
25464917 Results suggest that KMO variation influences a range of cognitive domains known to predict functional outcome in schizophrenia
24316190 Study reporting on the first successful bacterial (Escherichia coli) expression of active FLAGtrade mark-tagged human KMO enzyme expressed in the soluble fraction and progress towards its purification.
23459468 findings from five independent cohorts suggest that genetic variation in KMO influences the risk for psychotic features in mania of bipolar disorder patients.
21727251 significant and correlated reduction in gene expression and enzyme activity in the frontal eye field in schizophrenia patients; rs2275163 has modest effects on predictive pursuit and visuospatial working memory endophenotypes
21693093 analyzed association between KMO gene polymorphisms and CSF concentrations of kynurenic acid in patients with schizophrenia and controls. results suggest that the nonsynonymous KMO SNP rs1053230 influences CSF concentrations of KYNA.
21030213 The present analysis of the combined Scandinavian sample did not reveal any allele frequency difference between patients and healthy controls
21030213 Observational study of gene-disease association. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVG      1 - 70
LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN     71 - 140
PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP    141 - 210
NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLL    211 - 280
PAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRI    281 - 350
PDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK    351 - 420
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISR        421 - 486
//

Text Mined References (22)

PMID Year Title
26099564 2015 Prognostic significance of kynurenine 3-monooxygenase and effects on proliferation, migration, and invasion of human hepatocellular carcinoma.
25715464 2014 [Association of kynurenine-3-monooxygenase gene with schizophrenia].
25464917 2014 Influence of kynurenine 3-monooxygenase (KMO) gene polymorphism on cognitive function in schizophrenia.
24316190 2014 Bacterial expression of human kynurenine 3-monooxygenase: solubility, activity, purification.
23459468 2014 The KMO allele encoding Arg452 is associated with psychotic features in bipolar disorder type 1, and with increased CSF KYNA level and reduced KMO expression.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21727251 2011 Downregulated kynurenine 3-monooxygenase gene expression and enzyme activity in schizophrenia and genetic association with schizophrenia endophenotypes.
21693093 2012 Kynurenine 3-monooxygenase polymorphisms: relevance for kynurenic acid synthesis in patients with schizophrenia and healthy controls.
21030213 2011 Kynurenine 3-monooxygenase (KMO) polymorphisms in schizophrenia: an association study.
More...