Property Summary

Ligand Count 55
NCBI Gene PubMed Count 26
PubMed Score 134.06
PubTator Score 63.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.400 8.5e-04
Breast cancer 2.400 1.2e-05
breast carcinoma 2.100 3.6e-26
cutaneous lupus erythematosus 3.600 1.1e-04
cystic fibrosis -1.200 1.4e-02
ductal carcinoma in situ 4.000 1.1e-03
glioblastoma 1.200 9.7e-04
head and neck cancer and chronic obstruc... 1.300 6.8e-03
interstitial cystitis 2.600 5.7e-03
invasive ductal carcinoma 3.400 1.9e-04
lung cancer -1.300 1.3e-02
lung carcinoma -2.900 1.8e-18
Multiple Sclerosis 1.300 5.7e-03
nephrosclerosis -1.617 8.0e-03
non-small cell lung cancer -2.050 4.3e-14
oligodendroglioma -1.200 3.8e-02
osteosarcoma -1.630 2.7e-02
pancreatic ductal adenocarcinoma liver m... -1.319 4.7e-02
primary Sjogren syndrome 1.500 3.0e-03
psoriasis 1.200 8.5e-24
tuberculosis -3.500 8.0e-08
ulcerative colitis 1.900 4.0e-05

Protein-protein Interaction (2)

Gene RIF (17)

AA Sequence

MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVG      1 - 70
LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN     71 - 140
PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP    141 - 210
NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLL    211 - 280
PAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRI    281 - 350
PDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK    351 - 420
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISR        421 - 486
//

Text Mined References (26)

PMID Year Title