Property Summary

Ligand Count 3
NCBI Gene PubMed Count 30
PubMed Score 68.09
PubTator Score 53.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Rhizomelic chondrodysplasia punctata, type 2 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.3e-05
group 3 medulloblastoma 4104 1.2e-03
Multiple myeloma 1332 3.6e-03
lung cancer 4740 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rhizomelic chondrodysplasia punctata 11 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.2e-03
lung cancer 1.500 1.3e-02
Multiple myeloma 1.266 3.6e-03
ovarian cancer -1.200 2.3e-05

Gene RIF (11)

AA Sequence

MESSSSSNSYFSVGPTSPSAVVLLYSKELKKWDEFEDILEERRHVSDLKFAMKCYTPLVYKGITPCKPID      1 - 70
IKCSVLNSEEIHYVIKQLSKESLQSVDVLREEVSEILDEMSHKLRLGAIRFCAFTLSKVFKQIFSKVCVN     71 - 140
EEGIQKLQRAIQEHPVVLLPSHRSYIDFLMLSFLLYNYDLPVPVIAAGMDFLGMKMVGELLRMSGAFFMR    141 - 210
RTFGGNKLYWAVFSEYVKTMLRNGYAPVEFFLEGTRSRSAKTLTPKFGLLNIVMEPFFKREVFDTYLVPI    211 - 280
SISYDKILEETLYVYELLGVPKPKESTTGLLKARKILSENFGSIHVYFGDPVSLRSLAAGRMSRSSYNLV    281 - 350
PRYIPQKQSEDMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSMDFDALVEKTLWLKGLTQAFG    351 - 420
GFLIWPDNKPAEEVVPASILLHSNIASLVKDQVILKVDSGDSEVVDGLMLQHITLLMCSAYRNQLLNIFV    421 - 490
RPSLVAVALQMTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGCYLLCKSEAIQVTTKDILVTE    491 - 560
KGNTVLEFLVGLFKPFVESYQIICKYLLSEEEDHFSEEQYLAAVRKFTSQLLDQGTSQCYDVLSSDVQKN    561 - 630
ALAACVRLGVVEKKKINNNCIFNVNEPATTKLEEMLGCKTPIGKPATAKL                        631 - 680
//

Text Mined References (33)

PMID Year Title