Property Summary

NCBI Gene PubMed Count 26
Grant Count 88
R01 Count 61
Funding $8,023,642.66
PubMed Score 245.35
PubTator Score 70.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
ependymoma -1.100 0.006
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000

Synonym

Accession O15226 G3V1N1 Q4VC41 Q9UJ91 NFkB-repressing factor
Symbols NRF
ITBA4

Gene

Gene RIF (20)

PMID Text
26340924 NF-kappaB-repressing factor (NKRF) phosphorylation modulates promoter-proximal transcription elongation of NF-kappaB/NKRF-regulated genes via direct interactions with elongation complex in response to specific stimuli
25277410 MIR29 targets and reduces expression of CLDN1 and NKRF to increase intestinal permeability in inflammatory bowel disease.
25135111 The up-regulated NKRF serves as an endogenous repressor for IP-10 and IL-8 synthesis to hinder host from robust response to MTb infection.
25010285 Tandem affinity purification and mass spectrometry analysis identify NFKappaB repressing factor (NKRF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
24223729 NRF may serve as an endogenous repressor to prevent robust increase in IP-10/CXCL10 and IL-8/CXCL8 when TB bacterial load is high.
23125841 Tandem affinity purification and mass spectrometry analysis identify NFKappaB repressing factor (NKRF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify NFKappaB repressing factor (NKRF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify NFKappaB repressing factor (NKRF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify NFKappaB repressing factor (NKRF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify NFKappaB repressing factor (NKRF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPVHFVASSSKDE      1 - 70
RQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGFILTKDQPVTANMYFDSGNPA     71 - 140
PSTTSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRCIQAC    141 - 210
KTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGYAGSKNGSRDRATELAVKLLQKRIEV    211 - 280
RVVRRKFKHTFGEDLVVCQIGMSSYEFPPALKPPEDLVVLGKDASGQPIFNASAKHWTNFVITENANDAI    281 - 350
GILNNSASFNKMSIEYKYEMMPNRTWRCRVFLQDHCLAEGYGTKKTSKHAAADEALKILQKTQPTYPSVK    351 - 420
SSQCHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIA    421 - 490
EAVGVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLR    491 - 560
KMGWTGGGLGKSGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFSRELTN    561 - 630
DERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN              631 - 690
//

Text Mined References (31)

PMID Year Title
26340924 2016 NF-?B-repressing factor phosphorylation regulates transcription elongation via its interactions with 5'?3' exoribonuclease 2 and negative elongation factor.
25277410 2015 MicroRNA 29 targets nuclear factor-?B-repressing factor and Claudin 1 to increase intestinal permeability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25135111 2014 NF-?B repressing factor downregulates basal expression and mycobacterium tuberculosis induced IP-10 and IL-8 synthesis via interference with NF-?B in monocytes.
24462208 2014 PAXT-1 promotes XRN2 activity by stabilizing it through a conserved domain.
24223729 2013 NF-?B repressing factor inhibits chemokine synthesis by peripheral blood mononuclear cells and alveolar macrophages in active pulmonary tuberculosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22441735 2012 Reduced nuclear factor-?B repressing factor: a link toward systemic inflammation in COPD.
More...