Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.4e-07
ovarian cancer 8520 9.2e-06
lung adenocarcinoma 2716 1.1e-04

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.600 1.1e-04
osteosarcoma 1.396 2.4e-07
ovarian cancer -1.100 9.2e-06

Synonym

Accession O15225 Q5JRR7 Q6NSX0
Symbols NCRNA00010

Gene

 Compartment GO Term (0)

AA Sequence

MSGPLSPVCSCPQLPFMLSPCHMHHHPGHVALSQTVSPASLLTQGLGLPQH                         1 - 51
//

Text Mined References (6)

PMID Year Title