Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.396 0.000
lung adenocarcinoma 1.600 0.000
ovarian cancer -1.100 0.000

Synonym

Accession O15225 Q5JRR7 Q6NSX0
Symbols NCRNA00010

Gene

 Compartment GO Term (0)

AA Sequence

MSGPLSPVCSCPQLPFMLSPCHMHHHPGHVALSQTVSPASLLTQGLGLPQH                         1 - 51
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9618446 1998 Regulation of X-chromosome inactivation in development in mice and humans.
9244435 1997 Escape from X inactivation of two new genes associated with DXS6974E and DXS7020E.