Property Summary

NCBI Gene PubMed Count 19
Grant Count 78
R01 Count 28
Funding $28,357,793.69
PubMed Score 307.39
PubTator Score 41.32

Knowledge Summary

Patent (4,572)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.062 0.000

Synonym

Accession O15218
Symbols AMR
7TMR
ADMR
AM-R
G10D
gamrh
hrhAMR

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (10)

PMID Text
23442365 Gene expression of adrenomedullin receptor components are differentially regulated in the uterus during the estrous cycle.
19847298 ADMR mediates the stimulatory effects of adrenomedullin on cancer cells and on endothelial and stellate cells within the tumor microenvironment
18976975 Knockdown of G protein-coupled receptor 182 (GPR182) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17939601 distribution of adrenomedullin receptor (AM-R )in the villous and extravillous trophoblast cells of the placenta and in chorion and decidua cells of the fetal membranes changed with gestational age but not with labor
14720432 Hybridization in situ showed that ADMR mRNA expression was significantly higher in pulmonary artery walls in patients with chronic obstructive pulmonary disease.
12646214 Chondrocyte phenotype cells expressed adrenomedullin and the adrenomedullin receptor, and secreted high concentration of adrenomedullin into the culture medium
12419522 The co-expression of Adm and its receptor in perineural fibroblasts and the expression of an Adm receptor in Schwann cells suggest autocrine and/or paracrine modes of action of Adm in peripheral nerves.
11956648 The cardiovascular response in sepsis: proposed mechanisms of the beneficial effect of adrenomedullin and its binding protein (review).
11712085 Endogenous ADM system plays a potentially important role in the paracrine or autocrine functional control of Conn's adenomas.
9535752 This putative G protein-coupled receptor remains an orphan, as the ability to bind and be activated by adrenomedullin has been refuted. A complex of CRLR and RAMP2 or RAMP3 gives a functional adrenomedullin receptor.

AA Sequence

MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVE      1 - 70
NLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSS     71 - 140
IFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFET    141 - 210
YSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLL    211 - 280
LTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCA    281 - 350
SSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS                    351 - 404
//

Text Mined References (19)

PMID Year Title
23442365 2013 Intermedin in rat uterus: changes in gene expression and peptide levels across the estrous cycle and its effects on uterine contraction.
19847298 2009 The ADMR receptor mediates the effects of adrenomedullin on pancreatic cancer cells and on cells of the tumor microenvironment.
17939601 2007 Localization and distribution of adrenomedullin receptor in the human placenta: changes with gestational age.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14720432 2003 [Study of the expression and role of adrenomedullin and adrenomedullin receptor in patients with chronic obstructive pulmonary disease].
12646214 2003 Expression of adrenomedullin and its receptor by chondrocyte phenotype cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419522 2002 Paracrine/autocrine function of adrenomedullin in peripheral nerves of rats.
11956648 2002 The cardiovascular response in sepsis: proposed mechanisms of the beneficial effect of adrenomedullin and its binding protein (review).
11883938 2002 Genomic organization and regulation of a human 7-helix transmembrane receptor which is expressed in pulmonary epithelial cells and induced in hypoxia.
More...