Property Summary

NCBI Gene PubMed Count 19
PubMed Score 324.77
PubTator Score 41.32

Knowledge Summary

Patent (4,572)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.6e-11
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.062 3.6e-11

Gene RIF (10)

AA Sequence

MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVE      1 - 70
NLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSS     71 - 140
IFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFET    141 - 210
YSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLL    211 - 280
LTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCA    281 - 350
SSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS                    351 - 404
//

Text Mined References (19)

PMID Year Title