Property Summary

NCBI Gene PubMed Count 55
Grant Count 55
R01 Count 49
Funding $4,316,887.43
PubMed Score 61.45
PubTator Score 79.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
24403508 Decreased gene expression of GSTA4 is associated with drug resistance in cervical cancer.
23650189 Data indicate that steroidogenic factor 1 (SF-1) and glutathione S-transferase A (GSTA) family genes (hGSTA1-hGSTA4) are involved in steroidogenesis.
23333304 HIV-1 Vif downregulates the expression of glutathione S-transferase alpha 4 (GSTA4) in Vif-expression T cells
23330092 drug resistance in three strains of tumor cells is associated with significant increase in hGSTP1 and hGSTA4 gene expression, whereas increased hGSTK1 gene expression was detected only in resistant erythroleukemia and mammary adenocarcinoma cells.
22038048 GSTA4 down-regulation and the concomitant increase in 4-hydroxynonenal adducts in muscle are indicative of susceptibility to infection in individuals with severe thermal injuries.
21751261 Data show that mandatory overexpression of hGSTA4 by transient transfection in KYSE30 cells and attenuation of HNE-induced EGFR phosphorylation.
20966433 Gsta4/GSTA4 is a novel susceptibility gene for NMSC that affects risk in both mice and humans.
20966433 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRS      1 - 70
ILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKIL     71 - 140
RGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDE    141 - 210
IYVRTVYNIFRP                                                              211 - 222
//

Text Mined References (56)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24403508 2014 Collateral sensitivity to cisplatin in KB-8-5-11 drug-resistant cancer cells.
23962720 2014 A genome-wide association study and biological pathway analysis of epilepsy prognosis in a prospective cohort of newly treated epilepsy.
23650189 2013 Human glutathione S-transferase A (GSTA) family genes are regulated by steroidogenic factor 1 (SF-1) and are involved in steroidogenesis.
23330092 2012 Expression of genes of glutathione transferase isoforms GSTP1-1, GSTA4-4, and GSTK1-1 in tumor cells during the formation of drug resistance to cisplatin.
22038048 2012 Down-regulation of glutatione S-transferase ? 4 (hGSTA4) in the muscle of thermally injured patients is indicative of susceptibility to bacterial infection.
21751261 2011 The balance between 4-hydroxynonenal and intrinsic glutathione/glutathione S-transferase A4 system may be critical for the epidermal growth factor receptor phosphorylation of human esophageal squamous cell carcinomas.
20966433 2010 Evidence that Gsta4 modifies susceptibility to skin tumor development in mice and humans.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
More...