Property Summary

NCBI Gene PubMed Count 58
PubMed Score 63.27
PubTator Score 79.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

 IMPC Phenotype (1)

Gene RIF (42)

AA Sequence

MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRS      1 - 70
ILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKIL     71 - 140
RGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDE    141 - 210
IYVRTVYNIFRP                                                              211 - 222
//

Text Mined References (59)

PMID Year Title