Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.70
PubTator Score 5.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.1e-05
ovarian cancer 8519 4.1e-04
group 3 medulloblastoma 4104 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.9e-02
ovarian cancer 1.200 4.1e-04
psoriasis 1.800 3.1e-05

Synonym

Accession O15213 A6NDP5 Q5HYZ0 Q5STK5 Q5STR3
Symbols UTP7
BING4
FP221
C6orf11

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Function (1)

Gene RIF (2)

AA Sequence

METAPKPGKDVPPKKDKLQTKRKKPRRYWEEETVPTTAGASPGPPRNKKNRELRPQRPKNAYILKKSRIS      1 - 70
KKPQVPKKPREWKNPESQRGLSGTQDPFPGPAPVPVEVVQKFCRIDKSRKLPHSKAKTRSRLEVAEAEEE     71 - 140
ETSIKAARSELLLAEEPGFLEGEDGEDTAKICQADIVEAVDIASAAKHFDLNLRQFGPYRLNYSRTGRHL    141 - 210
AFGGRRGHVAALDWVTKKLMCEINVMEAVRDIRFLHSEALLAVAQNRWLHIYDNQGIELHCIRRCDRVTR    211 - 280
LEFLPFHFLLATASETGFLTYLDVSVGKIVAALNARAGRLDVMSQNPYNAVIHLGHSNGTVSLWSPAMKE    281 - 350
PLAKILCHRGGVRAVAVDSTGTYMATSGLDHQLKIFDLRGTYQPLSTRTLPHGAGHLAFSQRGLLVAGMG    351 - 420
DVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLVPGAGEPNFDGLESNP    421 - 490
YRSRKQRQEWEVKALLEKVPAELICLDPRALAEVDVISLEQGKKEQIERLGYDPQAKAPFQPKPKQKGRS    491 - 560
STASLVKRKRKVMDEEHRDKVRQSLQQQHHKEAKAKPTGARPSALDRFVR                        561 - 610
//

Text Mined References (22)

PMID Year Title