Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.75
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.800 0.000
group 3 medulloblastoma 1.100 0.019
ovarian cancer 1.200 0.000

Synonym

Accession O15213 A6NDP5 Q5HYZ0 Q5STK5 Q5STR3
Symbols UTP7
BING4
FP221
C6orf11

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
23848194 When WDR46 was knocked down, nucleolin and DDX21 were mislocalized from the granular component to the edges of the nucleoli.
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

METAPKPGKDVPPKKDKLQTKRKKPRRYWEEETVPTTAGASPGPPRNKKNRELRPQRPKNAYILKKSRIS      1 - 70
KKPQVPKKPREWKNPESQRGLSGTQDPFPGPAPVPVEVVQKFCRIDKSRKLPHSKAKTRSRLEVAEAEEE     71 - 140
ETSIKAARSELLLAEEPGFLEGEDGEDTAKICQADIVEAVDIASAAKHFDLNLRQFGPYRLNYSRTGRHL    141 - 210
AFGGRRGHVAALDWVTKKLMCEINVMEAVRDIRFLHSEALLAVAQNRWLHIYDNQGIELHCIRRCDRVTR    211 - 280
LEFLPFHFLLATASETGFLTYLDVSVGKIVAALNARAGRLDVMSQNPYNAVIHLGHSNGTVSLWSPAMKE    281 - 350
PLAKILCHRGGVRAVAVDSTGTYMATSGLDHQLKIFDLRGTYQPLSTRTLPHGAGHLAFSQRGLLVAGMG    351 - 420
DVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLVPGAGEPNFDGLESNP    421 - 490
YRSRKQRQEWEVKALLEKVPAELICLDPRALAEVDVISLEQGKKEQIERLGYDPQAKAPFQPKPKQKGRS    491 - 560
STASLVKRKRKVMDEEHRDKVRQSLQQQHHKEAKAKPTGARPSALDRFVR                        561 - 610
//

Text Mined References (22)

PMID Year Title
24754225 2014 Dynamics of WD-repeat containing proteins in SSU processome components.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23848194 2013 Nucleolar scaffold protein, WDR46, determines the granular compartmental localization of nucleolin and DDX21.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22754713 2012 WDR46 is a Genetic Risk Factor for Aspirin-Exacerbated Respiratory Disease in a Korean Population.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...