Property Summary

NCBI Gene PubMed Count 15
Grant Count 6
R01 Count 6
Funding $436,278
PubMed Score 28.03
PubTator Score 14.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Corneal dystrophy 15 4.045 2.0

Expression

Gene RIF (4)

PMID Text
22632162 FITC-labeled Tat 47-59 peptide upregulates gene expression of prefoldin subunit 6 (PFDN6) in U-937 macrophages
19851445 Observational study of gene-disease association. (HuGE Navigator)
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
17257322 The localization of the HKE2 gene to the class II region, its cytoplasmic expression and putative protein-binding domain suggest that HKE2 may function in adaptive immunity and cancer.

AA Sequence

MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG      1 - 70
EARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA                71 - 129
//

Text Mined References (19)

PMID Year Title
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17257322 2007 Characterization of HKE2: an ancient antigen encoded in the major histocompatibility complex.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...