Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
Funding $51,271.4
PubMed Score 11.80
PubTator Score 10.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
ependymoma 1.500 0.002
oligodendroglioma 1.200 0.004
osteosarcoma -1.267 0.000
astrocytoma 1.200 0.013
pancreatic ductal adenocarcinoma liver m... 1.001 0.046
ovarian cancer 1.800 0.000

Gene RIF (5)

PMID Text
23898208 HIV-1 Tat downregulates the expression of ral guanine nucleotide dissociation stimulator-like 2 (RGL2) in human primary T cells
21160498 SAMD9, an IFN-gamma-responsive protein, interacts with RGL2 to diminish the expression of EGR1, a protein of direct relevance to the pathogenesis of ectopic calcification and inflammation.
20801877 Rgl2 and RalB both localized to the leading edge, and this localization of RalB was dependent on endogenous Rgl2 expression.
19851445 Observational study of gene-disease association. (HuGE Navigator)
18540861 RGL2 is phosphorylated by PKA and phosphorylation reduces the ability of RGL2 to bind H-Ras. results of the present study indicate that Ras may distinguish between the different RalGDS family members by their phosphorylation by PKA.

AA Sequence

MLPRPLRLLLDTSPPGGVVLSSFRSRDPEEGGGPGGLVVGGGQEEEEEEEEEAPVSVWDEEEDGAVFTVT      1 - 70
SRQYRPLDPLVPMPPPRSSRRLRAGTLEALVRHLLDTRTSGTDVSFMSAFLATHRAFTSTPALLGLMADR     71 - 140
LEALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGVGGGSADLIRN    141 - 210
LRSRVDPQAPDLPKPLALPGDPPADPTDVLVFLADHLAEQLTLLDAELFLNLIPSQCLGGLWGHRDRPGH    211 - 280
SHLCPSVRATVTQFNKVAGAVVSSVLGATSTGEGPGEVTIRPLRPPQRARLLEKWIRVAEECRLLRNFSS    281 - 350
VYAVVSALQSSPIHRLRAAWGEATRDSLRVFSSLCQIFSEEDNYSQSRELLVQEVKLQSPLEPHSKKAPR    351 - 420
SGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQR    421 - 490
WLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWTEVLGSVGVPTPLVSCDRPSTGGDEAP    491 - 560
TTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPSHLSPPASSPRPSRGHRRSASCGSPLSGGAEE    561 - 630
ASGGTGYGGEGSGPGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELV    631 - 700
QLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGVTSGPSASGTPPSEGGGGSFPRIKATGR    701 - 770
KIARALF                                                                   771 - 777
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21160498 2011 Functional characterization of SAMD9, a protein deficient in normophosphatemic familial tumoral calcinosis.
20801877 2010 Aberrant overexpression of the Rgl2 Ral small GTPase-specific guanine nucleotide exchange factor promotes pancreatic cancer growth through Ral-dependent and Ral-independent mechanisms.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18540861 2008 G-protein binding features and regulation of the RalGDS family member, RGL2.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
More...