Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.65
PubTator Score 10.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.200 1.3e-02
ependymoma 1.500 2.4e-03
malignant mesothelioma 1.100 2.8e-06
oligodendroglioma 1.200 3.5e-03
osteosarcoma -1.267 8.9e-05
ovarian cancer 1.800 4.7e-06
pancreatic ductal adenocarcinoma liver m... 1.001 4.6e-02

Gene RIF (5)

AA Sequence

MLPRPLRLLLDTSPPGGVVLSSFRSRDPEEGGGPGGLVVGGGQEEEEEEEEEAPVSVWDEEEDGAVFTVT      1 - 70
SRQYRPLDPLVPMPPPRSSRRLRAGTLEALVRHLLDTRTSGTDVSFMSAFLATHRAFTSTPALLGLMADR     71 - 140
LEALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGVGGGSADLIRN    141 - 210
LRSRVDPQAPDLPKPLALPGDPPADPTDVLVFLADHLAEQLTLLDAELFLNLIPSQCLGGLWGHRDRPGH    211 - 280
SHLCPSVRATVTQFNKVAGAVVSSVLGATSTGEGPGEVTIRPLRPPQRARLLEKWIRVAEECRLLRNFSS    281 - 350
VYAVVSALQSSPIHRLRAAWGEATRDSLRVFSSLCQIFSEEDNYSQSRELLVQEVKLQSPLEPHSKKAPR    351 - 420
SGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQR    421 - 490
WLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWTEVLGSVGVPTPLVSCDRPSTGGDEAP    491 - 560
TTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPSHLSPPASSPRPSRGHRRSASCGSPLSGGAEE    561 - 630
ASGGTGYGGEGSGPGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELV    631 - 700
QLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGVTSGPSASGTPPSEGGGGSFPRIKATGR    701 - 770
KIARALF                                                                   771 - 777
//

Text Mined References (22)

PMID Year Title