Property Summary

NCBI Gene PubMed Count 71
Grant Count 45
R01 Count 20
Funding $6,595,041.19
PubMed Score 210.81
PubTator Score 60.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 0.000

 GO Function (1)

Gene RIF (70)

PMID Text
26401002 repertoire of peptides eluted from MHC class I molecules was influenced by FAT10 expression
25983082 FAT10 is the only ubiquitin-like modifier known to date which directly targets its hundreds of substrates for degradation by the proteasome. (Review)
25768649 Conjugation of the ubiquitin activating enzyme UBE1 with the ubiquitin-like modifier FAT10 targets it for proteasomal degradation
25422469 the interaction of FAT10 with MAD2 is a key mechanism underlying the promalignant property of FAT10
25056121 Results identified a novel HCC regulatory circuit involving FAT10, beta-catenin/TCF4, and HOXB9, the dysfunction of which drives invasive and metastatic character in HCC.
24893112 transcription downregulation of the Ufm1 and FAT10 conjugation system in liver Mallory-Denk bodies formation
24518302 STAT3 and NFkappaB synergistically act for maximum induction of FAT10 expression.
24492942 FAT10 expression in pancreatic ductal adenocarcinoma (PDAC) was an independent prognostic factor of patients, which might be a potential diagnostic and therapeutic target of PDAC
24440736 These results suggest that knockdown of FAT10 by adenovirus-delivered siRNA may be a promising therapeutical strategy for treatment of hepatocellular carcinoma.
24325913 FAT10 can induce malignant transformation as evidenced from the anchorage-independent growth as well as in vivo tumor-forming abilities of FAT10-overexpressing NeHepLxHT cells.
More...

AA Sequence

MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDK      1 - 70
EKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLE     71 - 140
DGKMMADYGIRKGNLLFLACYCIGG                                                 141 - 165
//

Text Mined References (74)

PMID Year Title
26401002 2015 The Ubiquitin-like Modifier FAT10 Is Selectively Expressed in Medullary Thymic Epithelial Cells and Modifies T Cell Selection.
25983082 2015 The ubiquitin-like modifier FAT10 in antigen processing and antimicrobial defense.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25768649 2015 Conjugation of the ubiquitin activating enzyme UBE1 with the ubiquitin-like modifier FAT10 targets it for proteasomal degradation.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25422469 2014 Disruption of FAT10-MAD2 binding inhibits tumor progression.
25056121 2014 Ubiquitin-like protein FAT10 promotes the invasion and metastasis of hepatocellular carcinoma by modifying ?-catenin degradation.
24893112 2014 Ufmylation and FATylation pathways are downregulated in human alcoholic and nonalcoholic steatohepatitis, and mice fed DDC, where Mallory-Denk bodies (MDBs) form.
24528925 2014 Investigations into the auto-FAT10ylation of the bispecific E2 conjugating enzyme UBA6-specific E2 enzyme 1.
24518302 2014 NF?B and STAT3 synergistically activate the expression of FAT10, a gene counteracting the tumor suppressor p53.
More...