Property Summary

NCBI Gene PubMed Count 83
PubMed Score 223.09
PubTator Score 60.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Biliary cirrhosis 45
Liver carcinoma 240
Disease Target Count P-value
psoriasis 6694 5.8e-26
Disease Target Count Z-score Confidence
Cancer 2499 3.255 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 5.8e-26

 GO Function (1)

Gene RIF (71)

AA Sequence

MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDK      1 - 70
EKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLE     71 - 140
DGKMMADYGIRKGNLLFLACYCIGG                                                 141 - 165
//

Text Mined References (86)

PMID Year Title