Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.94
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
psoriasis 4.300 0.000
cutaneous lupus erythematosus 5.200 0.000
glioblastoma 2.100 0.009
medulloblastoma 1.600 0.001
atypical teratoid / rhabdoid tumor 2.300 0.000
primitive neuroectodermal tumor 2.100 0.023
ulcerative colitis -1.589 0.035
tuberculosis -5.000 0.000
non-small cell lung cancer 2.712 0.000
colon cancer -2.600 0.000
lung cancer 1.600 0.000
sarcoidosis 4.500 0.013
interstitial cystitis 3.900 0.008
lung adenocarcinoma 2.400 0.000
pediatric high grade glioma 1.600 0.004
primary Sjogren syndrome 2.800 0.000
invasive ductal carcinoma 4.000 0.001
breast carcinoma 1.700 0.000
ductal carcinoma in situ 3.500 0.002
ovarian cancer 1.200 0.005
Breast cancer 2.300 0.000
head and neck cancer and chronic obstruc... 2.100 0.012

Gene RIF (6)

PMID Text
25564618 We hypothesize that these unique features of ADAMDEC1 may have evolved to escape from inhibition by endogenous metalloprotease inhibitors
23754285 ADAMDEC1 functions as an active metalloprotease.
19218196 Gene expression profiling performed on tissues obtained from pulmonary sarcoidosis patients identified ADAMDEC1 as a potential pathogenic mediator of lung damage and/or remodeling and may serve as a marker for this disease.
18449420 The ADAMDEC 1 haplotype may indicate an underlying mechanism for high FVIII levels in venous thromboembolism.
18449420 Observational study of gene-disease association. (HuGE Navigator)
12037602 molecular evolution by duplication in a metalloprotease gene cluster on chromosome 8p12

AA Sequence

MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEE      1 - 70
RYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASI     71 - 140
STCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEK    141 - 210
EDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVV    211 - 280
PSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVM    281 - 350
SHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTT    351 - 420
PVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE                        421 - 470
//

Text Mined References (14)

PMID Year Title
25564618 2015 Evidence for restricted reactivity of ADAMDEC1 with protein substrates and endogenous inhibitors.
23754285 2013 ADAMDEC1 is a metzincin metalloprotease with dampened proteolytic activity.
19218196 2009 Gene expression profiling identifies MMP-12 and ADAMDEC1 as potential pathogenic mediators of pulmonary sarcoidosis.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18449420 2008 Association of ADAMDEC1 haplotype with high factor VIII levels in venous thromboembolism.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14632642 2003 Inverse regulation of the ADAM-family members, decysin and MADDAM/ADAM19 during monocyte differentiation.
More...