Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.76
PubTator Score 10.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.400 1.9e-03
atypical teratoid / rhabdoid tumor 2.300 1.9e-05
Breast cancer 2.300 2.9e-04
breast carcinoma 1.700 1.1e-19
colon cancer -1.900 7.9e-03
cutaneous lupus erythematosus 5.200 3.1e-05
ductal carcinoma in situ 3.500 2.0e-03
glioblastoma 1.700 2.6e-04
group 3 medulloblastoma 1.500 4.3e-02
head and neck cancer and chronic obstruc... 2.100 1.2e-02
interstitial cystitis 3.900 8.2e-03
invasive ductal carcinoma 1.259 6.3e-04
lung adenocarcinoma 1.100 4.7e-05
lung cancer 1.600 4.8e-04
non primary Sjogren syndrome sicca -1.500 2.5e-02
non-small cell lung cancer 2.712 7.5e-13
ovarian cancer 1.200 5.3e-03
primitive neuroectodermal tumor 2.100 2.3e-02
psoriasis 2.300 6.3e-07
sarcoidosis 4.500 1.3e-02
tuberculosis -5.000 1.5e-09
ulcerative colitis -1.589 3.5e-02

Gene RIF (7)

AA Sequence

MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEE      1 - 70
RYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASI     71 - 140
STCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEK    141 - 210
EDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVV    211 - 280
PSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVM    281 - 350
SHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTT    351 - 420
PVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE                        421 - 470
//

Text Mined References (15)

PMID Year Title