Property Summary

NCBI Gene PubMed Count 30
Grant Count 17
R01 Count 12
Funding $1,018,267
PubMed Score 220.29
PubTator Score 21.56

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26122142 Case Report: hamartomatous olyposis and gastrointestinal ganglioneuromas with SMAD9 germline mutation that reduces PTEN expression.
24008158 HIV-1 Tat-treated pulmonary arterial smooth muscle cells modulate levels of phosphorylated SMAD1/5/8 proteins and SMAD1/5/8-SMAD4 protein complex, which are repressed by cocaine exposure
23804438 a detailed computational model for TGF-beta signalling that incorporates elements of previous models together with crosstalking between Smad1/5/8 and Smad2/3 channels through a negative feedback loop dependent on Smad7.
23384547 ATP production by NaF promotes hypertrophy-like changes via activation of phospho-Smad8
22897816 TNF activated NF-kappaB pathway and inhibited the phosphorylation of Smad 1/5/8 and BMP-2-induced osteoblastic differentiation in BMMSCs
22707059 CREBZF, a novel Smad8-binding protein.
22452883 Data suggest that Smads 1, 5 and 8 as potential prognostic markers and therapeutic targets for mTOR inhibition therapy of prostate cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19269967 increases of p16(INK4a) and p21(WAF1/cip1) expression in response to BMP4 were mediated by the Smad1/5/8 signaling pathway.
19244313 5-HT transactivates the serine kinase receptor, BMPR 1A, to activate Smads 1/5/8 via Rho and Rho kinase in in bovine and human pulmonary artery smooth muscle cells
More...

AA Sequence

MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVT      1 - 70
IPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLP     71 - 140
PVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSP    141 - 210
GSPSEPESPYQHSVDTPPLPYHATEASETQSGQPVDATADRHVVLSIPNGDFRPVCYEEPQHWCSVAYYE    211 - 280
LNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECV    281 - 350
SDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVK    351 - 420
GWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS                           421 - 467
//

Text Mined References (31)

PMID Year Title
26122142 2015 Exome Sequencing Reveals Germline SMAD9 Mutation That Reduces Phosphatase and Tensin Homolog Expression and Is Associated With Hamartomatous Polyposis and Gastrointestinal Ganglioneuromas.
23804438 2013 Computational modelling of Smad-mediated negative feedback and crosstalk in the TGF-? superfamily network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23384547 2013 Impaired glycolytic metabolism causes chondrocyte hypertrophy-like changes via promotion of phospho-Smad1/5/8 translocation into nucleus.
22897816 2013 Activated NF-?B in bone marrow mesenchymal stem cells from systemic lupus erythematosus patients inhibits osteogenic differentiation through downregulating Smad signaling.
22707059 2012 CREBZF, a novel Smad8-binding protein.
22452883 2012 Inhibition of mTORC1 kinase activates Smads 1 and 5 but not Smad8 in human prostate cancer cells, mediating cytostatic response to rapamycin.
21898662 2011 Molecular genetic characterization of SMAD signaling molecules in pulmonary arterial hypertension.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19269967 2009 BMP4-Smad signaling pathway mediates adriamycin-induced premature senescence in lung cancer cells.
More...