Property Summary

NCBI Gene PubMed Count 50
Grant Count 132
R01 Count 54
Funding $26,929,279.08
PubMed Score 32.30
PubTator Score 44.34

Knowledge Summary

Patent (48,807)

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma -2.100 0.000
ependymoma -2.700 0.000
oligodendroglioma -2.200 0.000
psoriasis -1.300 0.000
cutaneous lupus erythematosus -1.900 0.028
glioblastoma -2.900 0.000
osteosarcoma -2.412 0.000
sonic hedgehog group medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -1.900 0.036
primitive neuroectodermal tumor -3.600 0.000
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -3.500 0.000
non primary Sjogren syndrome sicca 1.100 0.016
subependymal giant cell astrocytoma -2.102 0.043
ovarian cancer -1.800 0.000
pituitary cancer 2.500 0.000

Synonym

Accession O15197 A4D2I7 A8CDT5 D3DXD3 Q2TB23 Q2TB24
Symbols HEP

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (25)

PMID Text
26468391 EphB6 is a new biomarker for distinguishing high- and low-grade ovarian serous carcinoma, and may be a potential prognostic marker in ovarian serous carcinomas.
25331796 Studies clearly demonstrate an inverse relationship between the levels of phospho-ERK and the abundance of cadherin 17, beta-catenin and phospho-GSK3beta in EPHB6-expressing MDA-MB-231 cells.
25239188 These findings implicate EphB6 as a negative regulator of EphA2 oncogenic signaling.
25152371 EphB6 also interacts with the Hsp90 chaperone.
24912672 Results suggest that erythropoietin-producing hepatocyte (Eph) receptor B6 (EphB6) may represent a useful tissue biomarker for the prediction of survival rate in colorectal cancers (CRCs).
24836890 We demonstrate that EphB6 reexpression forces metastatic melanoma cells to deviate from the canonical migration pattern observed in the chick embryo transplant model
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with EPHB6
22039307 Our work shows that EphB3 is consistently expressed by malignant T lymphocytes, most frequently in combination with EphB6, and that stimulation with their common ligands strongly suppresses Fas-induced apoptosis in these cells.
21935409 Data found significant correlations between ephA2, ephA4, ephA7, ephB4, and ephB6 and overall and/or recurrence-free survival in large microarray datasets.
21811619 The alterations in miRNAs and their target mRNAs also suggest indirect involvement of EphB6 in PI3K/Akt/mTOR pathways.
More...

AA Sequence

MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTR      1 - 70
TFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDS     71 - 140
PDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWAVGPHGAGQRAGLQLNVKERSFGPLTQRGFY    141 - 210
VAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGS    211 - 280
PPRLHCNGEGKWMVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPC    281 - 350
LEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGG    351 - 420
GGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSA    421 - 490
VPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQV    491 - 560
RARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTE    561 - 630
QLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVA    631 - 700
IQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSL    701 - 770
QLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTT    771 - 840
SSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQ    841 - 910
LVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDV    911 - 980
AQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV                                 981 - 1021
//

Text Mined References (53)

PMID Year Title
26468391 2016 Expression of EphB6 in ovarian serous carcinoma is associated with grade, TNM stage and survival.
25416956 2014 A proteome-scale map of the human interactome network.
25331796 Modulation of liver-intestine cadherin (Cadherin 17) expression, ERK phosphorylation and WNT signaling in EPHB6 receptor-expressing MDA-MB-231 cells.
25239188 2014 EphB6 promotes anoikis by modulating EphA2 signaling.
25152371 2014 Ligand stimulation induces clathrin- and Rab5-dependent downregulation of the kinase-dead EphB6 receptor preceded by the disruption of EphB6-Hsp90 interaction.
24912672 2014 Loss of EphB6 protein expression in human colorectal cancer correlates with poor prognosis.
24836890 2014 Dynamic interactions between cancer cells and the embryonic microenvironment regulate cell invasion and reveal EphB6 as a metastasis suppressor.
23226491 2012 Mutations of the EPHB6 receptor tyrosine kinase induce a pro-metastatic phenotype in non-small cell lung cancer.
22223652 2012 Receptor tyrosine kinase Ephb6 regulates vascular smooth muscle contractility and modulates blood pressure in concert with sex hormones.
22039307 2011 EphB receptors trigger Akt activation and suppress Fas receptor-induced apoptosis in malignant T lymphocytes.
More...