Property Summary

Ligand Count 8
NCBI Gene PubMed Count 55
PubMed Score 38.18
PubTator Score 44.34

Knowledge Summary

Patent (48,807)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.400 6.3e-05
astrocytic glioma -1.800 3.6e-03
Astrocytoma, Pilocytic -3.400 1.3e-11
atypical teratoid / rhabdoid tumor -3.200 1.2e-05
cutaneous lupus erythematosus -1.900 2.8e-02
ependymoma -2.100 8.9e-04
glioblastoma -2.600 1.2e-08
group 4 medulloblastoma -1.500 1.3e-02
medulloblastoma, large-cell -1.900 3.6e-02
non primary Sjogren syndrome sicca 1.100 1.6e-02
oligodendroglioma -1.400 2.7e-02
osteosarcoma -2.412 4.6e-08
ovarian cancer -1.800 1.2e-11
pituitary cancer 2.500 3.0e-05
primitive neuroectodermal tumor -3.600 6.5e-08
psoriasis -1.300 1.2e-07
subependymal giant cell astrocytoma -2.102 4.3e-02

Gene RIF (30)

AA Sequence

MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTR      1 - 70
TFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEEPDS     71 - 140
PDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSAAWAVGPHGAGQRAGLQLNVKERSFGPLTQRGFY    141 - 210
VAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGS    211 - 280
PPRLHCNGEGKWMVAVGGCRCQPGYQPARGDKACQACPRGLYKSSAGNAPCSPCPARSHAPNPAAPVCPC    281 - 350
LEGFYRASSDPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGG    351 - 420
GGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSA    421 - 490
VPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGFQV    491 - 560
RARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVVFQRKRRGTGYTE    561 - 630
QLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVA    631 - 700
IQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSL    701 - 770
QLVAMQRGVAAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTT    771 - 840
SSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQ    841 - 910
LVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDV    911 - 980
AQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV                                 981 - 1021
//

Text Mined References (58)

PMID Year Title