Property Summary

NCBI Gene PubMed Count 19
PubMed Score 152.71
PubTator Score 20.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia -1.300 3.9e-02
cutaneous lupus erythematosus -1.100 7.1e-03
Duchenne muscular dystrophy 1.195 5.4e-11
glioblastoma -1.100 7.7e-04
group 4 medulloblastoma -1.100 1.9e-03
intraductal papillary-mucinous adenoma (... 1.300 3.0e-02
intraductal papillary-mucinous neoplasm ... 1.600 2.1e-02
lung adenocarcinoma -1.300 1.8e-17
lung cancer -1.100 3.0e-04
malignant mesothelioma 1.600 7.6e-07
medulloblastoma, large-cell -1.500 1.3e-04
non-small cell lung cancer -1.136 7.8e-17
osteosarcoma 1.247 1.1e-02
ovarian cancer -1.800 1.1e-05
pancreatic cancer 1.600 5.1e-04
pancreatic carcinoma 1.600 5.1e-04
psoriasis 1.400 1.3e-04
tuberculosis 1.100 1.9e-03
ulcerative colitis -1.200 2.8e-05

Gene RIF (13)

AA Sequence

MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLV      1 - 70
EENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTI     71 - 140
HQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSR    141 - 210
LGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR        211 - 276
//

Text Mined References (22)

PMID Year Title