Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 7
Funding $1,471,288.25
PubMed Score 148.96
PubTator Score 20.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
pancreatic cancer 1.600 0.001
malignant mesothelioma 1.800 0.000
cutaneous lupus erythematosus -1.400 0.003
psoriasis -1.600 0.000
osteosarcoma -1.309 0.014
glioblastoma -1.100 0.001
medulloblastoma, large-cell -2.100 0.000
Duchenne muscular dystrophy 1.195 0.000
tuberculosis 1.100 0.002
non-small cell lung cancer -1.136 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.030
intraductal papillary-mucinous neoplasm ... 1.600 0.021
lung cancer -1.100 0.000
lung adenocarcinoma -1.300 0.000
group 4 medulloblastoma -1.600 0.000
pancreatic carcinoma 1.600 0.001
acute myeloid leukemia -1.300 0.039
ulcerative colitis -1.200 0.000
ovarian cancer -1.800 0.000

Gene RIF (11)

PMID Text
21643017 identified RBSP3, a phosphatase-like tumor suppressor, as a bona fide target of miR-100 and validated that RBSP3 was involved in cell differentiation and survival in acute myeloid leukemia
20412120 dysregulation of hMLH1, ITGA9, and RBSP3 associated multiple cellular pathways are needed for the development of early dysplastic lesions of the head and neck.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20193080 tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A are downregulated in primary non-small cell lung cancer
19885927 In cervical intraepithelial neoplasms and uterine cervical carinoma, RBSP3 is oftne deletd, compared with other genes.
19478941 This is the first report of high frequencies of somatic mutations in RASSF1 and RBSP3 in different cancers suggesting it may underlay the mutator phenotype of cancer.
19140316 Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer
19047128 Observational study of gene-disease association. (HuGE Navigator)
19016758 Frequent alterations of RBSP3 at chromosomal 3p22.3 region in early and late-onset breast carcinoma are reported with reference to clinical and prognostic significance.
17085434 SCP3 acts as a phosphatase for regulatory phosphorylations in the linker regions of Smad1 and Smad2.
More...

AA Sequence

MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLV      1 - 70
EENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTI     71 - 140
HQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSR    141 - 210
LGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR        211 - 276
//

Text Mined References (19)

PMID Year Title
21643017 2012 MiR-100 regulates cell differentiation and survival by targeting RBSP3, a phosphatase-like tumor suppressor in acute myeloid leukemia.
20412120 2010 Frequent alterations of the candidate genes hMLH1, ITGA9 and RBSP3 in early dysplastic lesions of head and neck: clinical and prognostic significance.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20193080 2010 Simultaneous down-regulation of tumor suppressor genes RBSP3/CTDSPL, NPRL2/G21 and RASSF1A in primary non-small cell lung cancer.
19885927 2010 RBSP3 is frequently altered in premalignant cervical lesions: clinical and prognostic significance.
19478941 2009 High mutability of the tumor suppressor genes RASSF1 and RBSP3 (CTDSPL) in cancer.
19140316 [Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer].
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
19016758 2008 Frequent alterations of hMLH1 and RBSP3/HYA22 at chromosomal 3p22.3 region in early and late-onset breast carcinoma: clinical and prognostic significance.
More...